KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0762Help
Entry
SpyM3_0762        CDS       T00089                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SpyM3_0762 (folK)
Enzymes [BR:spg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SpyM3_0762 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
815595..816083
Genome map
AA seq 162 aa AA seqDB search
MTIVYLSLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTSQADFLNMAYQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKLLRDYLAALDQSDITLFSAQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgggggaccgagcagcttacttgcaa
aaagctcttgaggctttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacgactgcttggggcaagacaagccaggctgattttctcaatatggcctatcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgatattgacatcctgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagcttttaagggattatcttgcagctttagatcaatcagatatcacgctcttttca
gctcaatag

DBGET integrated database retrieval system