KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_0798Help
Entry
SpyM3_0798        CDS       T00089                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850011..850550
Genome map
AA seq 179 aa AA seqDB search
MNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDGFGIVSSRIGMRREAIPISNDMDIFT
FIAQLEEKPYCVLIDESQFLSKQNVYDLARVVDELNVPVMAFGLKNDFQNNLFEGSKHLL
LLADKIDEIKTICQYCSKKATMVLRIENGKPVYEGDQIQIGGNETYIPVCRKHYFNPEI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaattctggtaaaaccattgaaattttaaaagttgctcataactatgaagaacaaggc
aaacctgttgtcattatgacaagtgctcttgatacacgtgatggttttggcatcgtctca
agccgtattggtatgcgacgagaagctattcccatttcaaatgacatggatattttcaca
tttattgcccaattggaggaaaaaccttattgtgtcctgattgacgaaagccaattttta
agcaagcaaaatgtttatgatttggcgcgtgtggtggatgagctaaatgttcctgtcatg
gcttttggtttgaaaaatgatttccaaaacaatctttttgaaggttcaaaacatttgcta
ttattggccgataagattgatgaaatcaaaacaatttgccaatactgtagtaagaaagca
accatggttttaaggatagaaaacggaaaacctgtctatgaaggtgatcagatacaaatt
ggtggtaatgaaacctatatcccagtttgtcgaaaacattattttaatccagagatttaa

DBGET integrated database retrieval system