KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1007Help
Entry
SpyM3_1007        CDS       T00089                                 

Gene name
bglA.2
Definition
(GenBank) putative beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00010  Glycolysis / Gluconeogenesis
spg00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM3_1007 (bglA.2)
   00500 Starch and sucrose metabolism
    SpyM3_1007 (bglA.2)
Enzymes [BR:spg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SpyM3_1007 (bglA.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AAM79614
UniProt: A0A0H2UUW5
Position
complement(1046793..1048193)
Genome map
AA seq 466 aa AA seqDB search
MKQRKHRYQFPDGFLWGSSTSGPQSEGTVPGDGKGPSNWDYWFSIESAKFHHQIGPEKTS
TFYENYKGDIALLKETGHTIFRTSIQWSRLIPEGVGEVNPKAVTFYREVFQDIIAQGIKL
IVNLYHFDLPYALQEKGGWENKATVWAYETYAKTCFELFGDLVNTWITFNEPIVPVECGY
LGYYHYPCKVDAKAAVQVAYNTQLASSLAVKACHKLHPDHKISIVLNMTPAYPRSDAPED
VKAARIAELFQTKSFLDPSVLGVYPAELVSILEEADLLPQYSADELEIIKNNTVDFLGVN
YYQPLRVQAPSKSQQEGDPLILDIYFEPYDMPGKKVNPHRGWEIYEPGLYDIALNLKEHY
GNIEWLVTENGMGVEGEEAFLADGQIQDDYRITFIEDHLIQLHKALGEGANCKGYLLWTF
IDCWSWLNAYKNRYGLVALDLESQKRTIKKSGYWFKALSESNGFDK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagaaaacaccgttatcaatttccagatggctttttatggggaagttccaca
tctgggcctcaaagcgaaggaacggttcctggagatggcaaaggacctagcaactgggat
tactggtttagtattgagtcagctaagtttcatcaccaaattggtccagaaaaaacctca
accttttatgaaaactataagggtgacattgcccttttgaaagaaacaggccacacgatt
tttcggacctcaatccagtggtctcgattgattccagaaggagtcggggaggttaatcca
aaggcggtgacattttaccgagaagtatttcaagacattattgctcaaggtattaaattg
attgttaacctctatcattttgacctcccctatgccttgcaagaaaaaggtggctgggaa
aacaaagctactgtctgggcttatgaaacctacgcaaaaacctgttttgagctttttggt
gatttagtaaacacttggattacctttaatgaaccgattgttccagtcgaatgtggctat
ttaggttattatcactacccttgtaaagtagatgccaaggcagcagttcaagtggcttac
aacacacaactggccagttcactggcggtcaaagcttgtcataagcttcatcccgaccac
aagattagtattgtgcttaacatgacacctgcttatcctcggagtgatgctcctgaagat
gtcaaggctgctagaatcgcagagcttttccaaaccaaatccttcctagatccatcagtt
ttgggtgtttacccagcagagttagtttccattttagaggaagctgatttattacctcaa
tatagtgctgatgaattagagattatcaaaaacaatactgttgattttttgggagttaat
tattatcagcctttgcgggttcaggcacctagtaagtcacagcaagagggggaccccctt
atcttagatatttattttgaaccttatgatatgcctggtaaaaaagtcaatcctcaccgg
ggttgggaaatttatgaaccaggactttatgatattgctcttaatttaaaagaacactat
ggtaacatcgaatggctagtcacggaaaatggtatgggtgtcgaaggtgaagaagctttt
ttagcagatggccagatacaagatgactaccgcatcacctttatagaggatcatcttatc
cagcttcataaggctttgggagaaggagccaactgcaaaggctacctcttgtggactttt
attgattgctggtcttggttaaatgcttataaaaaccgatatggtttggtagctttggat
ttagagagtcaaaagcgaaccataaaaaaatcaggttactggtttaaggcgttgagcgag
tcaaatggttttgataaatag

DBGET integrated database retrieval system