KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1033Help
Entry
SpyM3_1033        CDS       T00089                                 

Gene name
murZ
Definition
(GenBank) putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SpyM3_1033 (murZ)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SpyM3_1033 (murZ)
Enzymes [BR:spg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SpyM3_1033 (murZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1072331..1073545)
Genome map
AA seq 404 aa AA seqDB search
MAVSGAKNSVVALIPAIILADDIVILDGVPAISDVDSLIEIMELMGATVNYHGDTLEIDP
RGVQDIPMPYGKINSLRASYYFYGSLLGRFGQAVVGLPGGCDLGPRPIDLHLKAFEAMGV
EVSYEGENMNLSTNGQKIHGAHIYMDTVSVGATINTMVAATKAQGKTVIENAAREPEIID
VATLLNNMGAHIRGAGTDIITIQGVQKLHGTRHQVIPDRIEAGTYIALAAAIGKGVKITN
VLYEHLESFIAKLEEMGVRMTVEEDAIFVEKQESLKAITIKTSPYPGFATDLQQPLTPLL
LKADGRGTIIDTIYEKRINHVPELMRMGADISVIGGQIVYQGPSRLTGAQVKATDLRAGA
ALVTAGLMAEGKTEITNIEFILRGYASIIAKLTALGADIQLIED
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtttcaggggcaaaaaacagtgttgttgcgcttattccagcaatcatcttagcc
gatgatattgtgattcttgatggtgtacctgctattagtgatgtagatagtctgattgaa
atcatggagcttatgggagcaacagtaaactatcatggtgatactttagaaattgaccct
agaggggtgcaagacatcccgatgccttacggaaagattaatagtcttcgagcttcctat
tatttctacggtagtcttttaggtcgttttggacaagcagttgttggcttacctggtggt
tgcgatttaggaccaagaccaattgacttgcatttgaaggccttcgaggctatgggagtt
gaagtgtcttatgagggtgaaaatatgaatttatcgacaaatggtcaaaaaattcatggc
gctcatatctatatggacaccgttagtgtcggtgctacaattaatactatggttgcggca
acaaaagctcaaggtaaaacggttattgaaaacgctgcacgcgagccagagattattgat
gtggctactcttttgaataacatgggtgcgcatattcgtggagcaggtacagatattatt
acgatacaaggtgttcagaaattgcatggtactagacaccaagttattcctgatcgtatt
gaagcagggacttatatcgctttggcggcagctattggaaaaggtgttaagatcactaat
gttctttatgagcatttagagagtttcattgctaagttagaagaaatgggtgtccgtatg
acggtagaagaggatgctatctttgttgaaaagcaagaatccctcaaggctattacaatt
aaaacatctccttaccctggctttgccactgatttgcaacagccattaacgcccttgttg
ttaaaagcagatggtcgtggaacgattattgacactatatatgaaaagcgcattaaccat
gtgccagagttgatgcgcatgggagcagatatctcagttattggtggtcagattgtttat
caagggccgtctcgcctgacaggagctcaggtcaaagccactgatttacgtgccggagcg
gctctagtgactgctggtctaatggctgaaggcaagacagaaattactaatattgaattt
atcttacgtggctatgctagtatcattgcaaaattaacagcactaggggcagatattcaa
ttaatcgaagactaa

DBGET integrated database retrieval system