KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1180Help
Entry
SpyM3_1180        CDS       T00089                                 

Gene name
glcK
Definition
(GenBank) putative glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00010  Glycolysis / Gluconeogenesis
spg00052  Galactose metabolism
spg00500  Starch and sucrose metabolism
spg00520  Amino sugar and nucleotide sugar metabolism
spg00521  Streptomycin biosynthesis
spg01100  Metabolic pathways
spg01110  Biosynthesis of secondary metabolites
spg01120  Microbial metabolism in diverse environments
spg01130  Biosynthesis of antibiotics
spg01200  Carbon metabolism
Module
spg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SpyM3_1180 (glcK)
   00052 Galactose metabolism
    SpyM3_1180 (glcK)
   00500 Starch and sucrose metabolism
    SpyM3_1180 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SpyM3_1180 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SpyM3_1180 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SpyM3_1180 (glcK)
Enzymes [BR:spg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SpyM3_1180 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAM79787
UniProt: A0A0H2UVA6
Position
complement(1207374..1208345)
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgttggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcttatgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacatttttatggcagcagaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system