KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1285Help
Entry
SpyM3_1285        CDS       T00089                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SpyM3_1285
  Lipid metabolism
   00600 Sphingolipid metabolism
    SpyM3_1285
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SpyM3_1285
Enzymes [BR:spg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SpyM3_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1288584..1292000)
Genome map
AA seq 1138 aa AA seqDB search
MISDSKEQTVTGYQYHYIDQEGRKQPFNQGWRFLMADVACAQDPSFDDSNWQVIHLPHDF
SLKQPYTRNGEAESAYKLGGVGWYRHYLVLDEVLAGCHVAITFEGSYMETEIYVNGQFIG
KHLNGYQEFTYDISDVVTFGAENLLAVRVENKVPSSRWYSGSGLYREVSLSVLPQLHFVA
DQVAMTLADTAVQEKGQQKVDLRFALNQSIQTYHYQLSLCLWEQSHCSKDKKLLYQETEV
PLADLAFQRQYGLTLSLEELQLWSPDNPHLYDLELTLYYQGQVIDCFCLETGFRQLTFTA
NQGLFVNGRAVKLKGVCLHHDQGGLGACAYEDALARQLVLLKDMGANTIRSTHNPSSPKL
RQLANRLGFFVIEEAFDTWTYAKNGNVNDFSNYFHQTIGTENASYLQRVRSPETSWAQYS
IEAMVWSAKNDPSVLMWSIGNELMEGFSADVSHYPELTRQMCQWIAAIDTSRPITFGDNK
LKEADFCWHEEVSQMATLLSQLDHPQGLIGLNYANGKDYDKLHEEHSDWLLYGSETASAI
TSRAYYKETKKVLDSGYHLTSYDHAKVDWGAFASQAWYDTITRDFVAGECVWTGFDYLGE
PTPWNKIDSGVVGLWPSPKNAYFGILDTAGFPKDSYYFYQSQWAQGQTTLHLLPVWQKDQ
LCFDEQGLVEVVVYSNAASVQLMFEDEQGNLTDYGRKAFHTYSTPTGHTYQLYQGADAAK
NPYENLYLTWRVPYQKGLLRAVAYDISGKSIPKTSGRSQVRTYGSVAKLSWKAFEAPIDA
PWELLYLDLSLLDSRGELVSHAQDWLKVQVEGPARLLALDNGNPTDHTPYQEPLRQAYGG
KLLAILALTGEAGHIKVTAKASQQLSSVFQTQVACRAPKEHLVTLPLEKYQFKKSRLTSQ
QEIGQSCLKTTQFLSVLENKDTQQKAGKASTPHILITSYQHYLPLPLQVCSQAFDFKKGD
DIFLPQWLQVKDAQGSFVKKAFPMTWYLKEKIFAKPILVTGYVSCFGQSIPVEARLNLAQ
ASKRRHQDLSLVAKQSLAASQKRLTYCYQYDTVQAIGAISLQNHTGTSLSVSVAISYGSQ
SSIKQETLMLADSHLSQLEEVIFFDDILTVLYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagatagcaaggagcagacagtgactggctaccaataccactatattgatcaa
gaaggaagaaagcagccctttaatcaaggctggcgttttcttatggcagatgtggcgtgt
gctcaggacccttcttttgatgattcgaactggcaggtgattcatttaccacatgatttc
agtcttaagcagccttacacaagaaatggtgaagctgaaagtgcttataaattaggtggt
gtcggttggtatcggcattatctcgtgttagatgaggttttagctggttgtcatgttgcc
attacttttgagggttcctatatggaaacggaaatttatgttaatgggcaattcattggc
aaacacttaaatggctatcaggaatttacctatgatatctctgatgttgtgacttttgga
gctgaaaatcttctggctgttcgggttgaaaacaaggttcccagttctcgttggtattca
ggcagtggtctttatcgtgaagtgagtttgtctgttcttccccagcttcattttgtggca
gaccaggtagcaatgaccttggctgatactgctgtgcaggagaaagggcaacagaaagtt
gatttacgctttgcccttaatcagtctattcagacttaccactaccaattgagcctctgt
ttatgggaacaatcacattgctcaaaagacaaaaaactcctttatcaagaaacagaagtg
cctctagctgatttggctttccaaagacagtatggtcttacactgtctttggaagaactc
caattgtggtcaccagataatcctcacctctacgatttagaactcactctttactatcaa
ggtcaggtcattgattgcttttgccttgaaactggttttcgtcagctgacttttacggcc
aatcaggggctttttgtgaatggcagagctgtcaaattaaagggagtttgtttgcatcat
gaccaaggaggcctaggagcttgtgcttacgaagatgccctagccagacaattagttctg
ttgaaagacatgggggctaataccattcgtagcacccataacccaagtagtcccaaactt
aggcaactagccaatcgtctcggcttttttgtgattgaagaagcctttgacacctggacc
tatgccaaaaatggaaacgttaatgacttttcaaactatttccatcagactatcggaact
gaaaatgcaagctatcttcaaagagtgaggtcacctgaaacgagctgggcccagtatagt
attgaggccatggtctggtctgccaagaatgacccgtcagtgttgatgtggtcgattggt
aatgaattgatggaaggtttttcagccgatgtcagtcattacccagagctgacaagacaa
atgtgccaatggattgctgctattgacacctcacgtcccattacctttggggacaataaa
ttaaaagaagctgacttttgctggcatgaggaagtgtcgcaaatggcaactcttcttagt
caattagaccatccccagggactcattgggttaaactatgctaatggaaaagactatgat
aagcttcatgaggagcactctgattggctgttgtatggttctgaaacagcctcagctatt
accagcagggcttattataaagagacaaaaaaagttcttgactccggttatcacctaacc
tcttatgatcatgctaaggtcgattggggtgccttcgctagccaggcttggtatgatacc
attacccgtgattttgttgctggcgaatgcgtttggacaggctttgattatttaggagaa
cctaccccctggaacaagatcgacagcggtgttgtaggcctttggccttctcctaaaaat
gcctactttggcattttagacacggcaggctttccaaaagatagctattatttttatcaa
agtcagtgggcgcaggggcagaccaccttgcacctgttaccagtctggcagaaggaccag
ctttgtttcgatgagcagggattggtggaagttgtggtttatagcaatgctgccagtgtg
caactgatgtttgaagatgagcagggcaacttaacagattatggaaggaaggcatttcat
acttatagcacgccaacgggacacacttatcagctttaccaaggagctgacgctgctaag
aatccttacgagaatctttacctgacttggcgagtgccctatcaaaaagggttgctaagg
gcagtggcctacgacatttctggtaaaagcattccaaaaaccagtggacgttctcaggtt
agaacctatggttcagtggcaaagctatcttggaaagcctttgaagcacctattgacgct
ccttgggaattgctttatctggatttatcactcttggatagccgaggtgaattggtcagc
catgctcaagattggctaaaggttcaagtagaaggaccagcccgtttgttggctcttgat
aatgggaatccgactgaccacaccccttatcaggagcctctacgccaggcatatggggga
aaattattagccattttagccctcactggagaggcgggacacattaaggtcacggcaaaa
gcctcgcagcaacttagcagtgtttttcagacacaagtagcctgccgtgcccccaaagaa
cacttagtgacactacctttagagaaatatcagtttaaaaagagccgactgacaagtcaa
caagaaattggtcaatcttgtctaaagaccacacaattcctttctgttttggagaacaaa
gacacccagcaaaaagcaggtaaggctagcacacctcacattcttatcaccagttaccag
cactatttacctctgcccttgcaggtttgttctcaggcatttgattttaaaaaaggcgat
gatatcttcttgcctcagtggctccaagtcaaagatgcccaaggttcttttgtgaaaaaa
gcttttccaatgacatggtacctaaaagagaaaatctttgccaagcctattcttgtcacg
ggctatgtttcttgttttgggcaatcaataccggttgaggcaaggcttaacctagcacaa
gctagcaaaagacggcaccaggatctcagtttagtcgccaagcaatccctggccgcaagt
caaaaaaggctaacttattgctaccaatatgatacggtgcaagccataggagccattagc
ttgcaaaatcacacaggcacatctcttagtgtttctgtggcaatcagttatggtagtcag
agctctattaagcaagaaaccttgatgctagctgatagccacttgagccagttagaagag
gttattttcttcgatgatattttgactgttttgtatctggcagtgacccttgaagtcatt
gaaggtcctgacctaactgaagacagtattcaaattggcctttgggatttagcatga

DBGET integrated database retrieval system