KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1407Help
Entry
SpyM3_1407        CDS       T00089                                 

Gene name
proB
Definition
(GenBank) putative gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
spg00330  Arginine and proline metabolism
spg00332  Carbapenem biosynthesis
spg01100  Metabolic pathways
spg01130  Biosynthesis of antibiotics
spg01230  Biosynthesis of amino acids
Module
spg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SpyM3_1407 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SpyM3_1407 (proB)
Enzymes [BR:spg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SpyM3_1407 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AAM80014
UniProt: P0DD22
Position
complement(1409714..1410535)
Genome map
AA seq 273 aa AA seqDB search
MMKRQFEDVTRIVIKIGTSSLVLPTGKINLEKIDQLAFVISSLMNKGKEVILVSSGAMGF
GLDILKMEKRPTNLAKQQAVSSVGQVAMMSLYSQIFAHYQTNVSQILLTRDVVVFPESLA
NVTNAFESLISFGIVPIVNENDAVSVDEMDHATKFGDNDRLSAVVAGITKADLLIMLSDI
DGLFDKNPTIYEDAQLRSHVAVITQEIIASAGGAGSKFGTGGMLSKIQSAQMVFENKGQM
VLMNGANPRDILRVLEGQPLGTWFKQIEEVRHD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgacaatttgaagatgtaacacgtatcgtaattaaaattggcactagttca
ttagtgctaccaacaggtaaaatcaatttagaaaaaatcgaccaactggcttttgtgatt
tcaagtttgatgaataagggcaaggaagttattttagtatcatcgggagcgatgggattt
ggactagatattttgaaaatggaaaaacgtccgaccaatcttgctaaacaacaggcagtt
tccagtgttggtcaggtagccatgatgagtctttattcacaaatttttgcacactaccaa
accaacgtgtcacaaattttattgacgagagatgtggtggttttcccagaaagtctagcc
aatgttaccaatgcttttgaaagtctgattagttttggcattgtgcctattgttaatgaa
aacgatgcggttagtgtggatgaaatggatcatgcgactaaatttggagataatgaccgt
ttatctgctgttgttgctggtattacaaaagctgatttattaatcatgttgtctgatatt
gatggcctttttgataaaaaccctactatttatgaggatgcgcagctacgcagccatgtt
gcagtcattacgcaagaaatcattgcgtcagcaggtggtgcgggcagtaaatttggcaca
ggtgggatgcttagcaaaattcaatctgcccagatggtatttgaaaacaaaggacagatg
gtcttgatgaatggagctaatcccagagatattttaagagtgcttgaagggcaaccgcta
ggcacctggttcaagcagatagaagaggtaaggcatgactga

DBGET integrated database retrieval system