KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1467Help
Entry
SpyM3_1467        CDS       T00089                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spg00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460081..1461919)
Genome map
AA seq 612 aa AA seqDB search
MEFSRETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAQGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKAEDFLLDDDGKIIGVKARDLLSDQEIIIKAKLVINTTGPWSDEI
RQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFDR
DENGLFTLAGGKITDYRKMAEGALTGIIQILKEEFGKSFKLINSKTYPVSGGEINPANVD
LEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLTAAEGLSLAETLSLHYAMD
YEMALKPTDYFLRRTNHLLFMRDSLDALIDPVINEMAKHFEWSDQERVAQEDDLRRVIAD
NDLSALKGHQEG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaagagaaacaagacgcttagctctccaaaaaatgcaagaaagagattta
gacctactgattattgggggaggtattacgggtgctggtgtggcacttcaggcggcagct
agtggcctagatacgggtctgattgagatgcaagattttgcgcaaggaacctctagccgt
tcaaccaaattggttcacggggggcttcgttacttgaaacaatttgatgtggaggtagtt
tcagatacggtgtcagagcgggctgtggtgcaacaaattgcaccccacattccaaaacca
gaccctatgttattacctgtttatgacgaacctggcagcacctttagcatgttccgtttg
aaggtcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaactaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcttg
cttggtggtggggtttaccttgatttccgcaataatgacgcaaggcttgttattgaaaat
atcaaacgagctaatcgtgatggggctcttattgctagtcatgtgaaagcagaagatttc
ttgctagatgacgatggtaagattattggtgtgaaggcgcgtgatctgctgtcagatcaa
gaaatcattatcaaggctaaattagtcatcaacaccacaggtccatggagtgatgagatt
cgtcaattctctcataagggacaaccgattcatcaaatgcgccctacaaaaggggtgcat
ctggtagtggaccgtcaaaaattaccagtgtctcaacctgtctatgttgacacagggtta
aatgatggtcgtatggtctttgtcttgccacgtgaagaaaaaacttattttggaacaacg
gacacggactacactggagacttggagcacccacaagttactcaagaagatgtggattat
ttgttaggcgttgtcaataaccgctttccaaatgccaacgtgaccattgatgatattgaa
agcagttgggctggtcttcgccccttgttatcaggtaatagtgcttctgactacaatggt
ggcaacagcggtaaagtcagtgatgatagttttgatcacttggttgatactgtcaaagcc
tatattaaccacgaagatagccgagaagctgttgaaaaagctattaagcaggttgaaacc
agcacatctgaaaaagaattggatccgtctgcagtgtcacgaggttcaagttttgaccgt
gatgagaatggactctttaccttggcaggtggtaagattaccgactatcgcaaaatggct
gaaggagcattgacagggattattcaaatcctcaaagaagagtttggcaaatccttcaag
cttatcaattcaaaaacctatcctgtttcaggaggtgaaatcaatccagccaatgtagat
ttagaaatagaagcctatgctcaattaggaactcttagtggtctttcgatggatgatgct
aggtatttggcaaacctttatggttctaatgcgccaaaagtctttgccttaactcgtcaa
ttaacagcagctgaagggttaagtttagctgaaaccttgtccttacattatgcgatggat
tatgaaatggcccttaaaccgacagattatttcttgagaagaacaaatcacctcttattt
atgcgagatagcctagatgctttgattgacccagtgattaatgaaatggctaaacatttt
gaatggtctgatcaggaaagagtggcacaagaagacgatcttcgtcgcgtgattgcagac
aatgatttgagtgccttaaaaggccatcaggagggttaa

DBGET integrated database retrieval system