KEGG   Streptococcus pyogenes MGAS315 (serotype M3): SpyM3_1593Help
Entry
SpyM3_1593        CDS       T00089                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spg  Streptococcus pyogenes MGAS315 (serotype M3)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SpyM3_1593 (recD)
Enzymes [BR:spg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SpyM3_1593 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592011..1594464
Genome map
AA seq 817 aa AA seqDB search
MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGTMADIIEGDDYTFWGE
LTQHPKYGQQLKLSRYQKIKPSSSGLVNYFSSDHFKGIGKKTAEKIIALYGHNTIDHILE
DPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSNRFAFQAFEKYKEEALDL
VKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALLHCLLEESINRGDTYVQAR
QLLDFAITLLEDARQVECDPTAVAEQLSELIIEGKIKNSDTKLFDASLYFAEEGIASNIS
RLLDTPLSQSFSHNTIQTTIQTVQKDFTITYDQVQQEAITKALTSKVFLLTGGPGTGKTT
VIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQVIIVGDSDQLPSVGPGQVLSDLL
KVNSLPQIALQKIFRQSQESTIVNLADQMRRGILAADFRDKKADRSYFEAQAAFIPDMIQ
KIVLSAIKSGIPAEKIQILAPMYKGQAGINHLNQLMQELLNPLQGQTEFLFNDTHFRKGD
KVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQDELILDFDGSEVTYPRNEWLKLTLAY
AMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYTAITRSKSKLILLGEYTAFEYAIKHEG
DKRQTYLIERFQEQSDLASSQPNQELKSKEQTSLFSNTATLEDDSQKSSSQSTNSNPTEN
SQSDNDDFRLTPENYSTIDSMIGLTESDIALFFQKKS
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtttttacaggtactgttgatcgtatcatttttgaaaaccaggctaatttc
tttaaaattctcctccttgccattgaggatacagacagtgacattgacgactttgaaatc
attatcacaggaacgatggctgacattattgaaggagatgactacaccttttggggggaa
ttgacccagcaccctaaatacggtcaacaactcaaactaagccgttaccaaaaaatcaaa
cctagttcatctggtttggttaattatttctctagtgaccattttaaggggattggtaaa
aaaacagcggagaaaatcattgcgctatatggtcataataccattgaccatattttagaa
gacccaagcaaattagaaactatctctggcctatctaaggctaatcgtcaagcctttgtc
gctaaactaaaattgaattacggcacagagcaactgattgctggtctcgtcgaacttggc
cttagcaaccgttttgcctttcaagcgtttgaaaagtataaagaagaggctcttgacctt
gttaaagaaaatccctatcagttagtcgaagatctacaaggttttgggtttaaaatggca
gatgctctcgctgaaaacttagggattgaaagcgactctccgaaacgttttcgtgcagcc
ctccttcactgtctcttggaagaatccatcaatcgaggagatacttatgtccaagcacga
caattattagactttgccatcacactccttgaagatgcacgtcaagtagaatgtgatcct
actgctgtggctgaacaactaagcgagttaatcatagagggcaaaatcaaaaacagtgac
accaaactgtttgatgctagcctttattttgctgaagaagggattgctagcaacatctct
cgtctcttagatactcctttaagtcagtcatttagtcataataccattcaaacaaccatc
caaaccgttcaaaaagactttaccatcacctatgaccaagtgcagcaagaagccattact
aaggccttaaccagcaaggtctttctcctaacaggtggtcccggaacaggaaaaacaact
gttattcgaggcattttgcaggcttacgcgaacctgcatcagattgatttggataaaaaa
gaccttcctatcttgttagcagctccaacaggtcgagctgcacgtcgcatgaatgagttg
actggacttcctagcgcaaccatccacaggcacttaggccttaatggcgacaacgattac
caagccatggaggattatctagactgcgacttgctgattgtcgatgaattttcaatggtg
gatacctggcttgccaaccagttgttaggagcgattaactcaacaactcaagtgattatt
gtcggagatagtgaccagcttccttcggttggacccggtcaagtcctgtcagatctttta
aaagtcaatagcctgccccaaatcgccttgcaaaagatatttcgtcaatcccaagaatct
actattgtcaatttggcagaccagatgcgtcgaggaatcttagctgctgactttcgtgat
aaaaaagctgaccgttcttattttgaagcccaagcagcctttatccctgacatgattcaa
aaaattgtcctatctgctattaaaagtggcatccctgctgagaaaattcaaattttagcg
cctatgtacaaaggacaagctggcatcaatcatcttaatcaactcatgcaagaacttctc
aatcccttgcaaggacaaacagaatttctgttcaatgatacgcattttcgtaaaggtgat
aaagtcctgcacttagtcaacgatgctcagttgaatgtctttaacggagatattggttat
attacagatttgattcctgctaaatacaccgaatctaaacaagacgaattaatcttagat
tttgacggtagcgaagtcacgtaccctagaaatgaatggctaaaattaaccctggcctat
gccatgagcattcataaatcgcaagggagtgagtttcaagtggtgattttacctatcaca
cgccaaagcggccgactcttgcaacgaaatgtgatttacacggccattactcggtctaaa
agtaagttaattctgttgggagaatatactgcctttgagtatgctattaaacacgaaggc
gataaacgccaaacctacttgatcgaacgcttccaagaacaatccgacttagcctcctct
caacctaaccaagagctaaaatcaaaagagcaaacctcccttttttctaatacggcaacc
cttgaggacgactctcaaaaatcttcctctcaatcaacaaactctaaccccactgagaac
tctcagtcagataatgatgattttaggttaacacctgagaattattcgactatcgattcg
atgatagggcttacagagtcagatattgccctctttttccagaaaaaatcctag

DBGET integrated database retrieval system