KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0121Help
Entry
MGAS10270_Spy0121 CDS       T00355                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00071  Fatty acid degradation
sph00072  Synthesis and degradation of ketone bodies
sph00280  Valine, leucine and isoleucine degradation
sph00310  Lysine degradation
sph00362  Benzoate degradation
sph00380  Tryptophan metabolism
sph00620  Pyruvate metabolism
sph00630  Glyoxylate and dicarboxylate metabolism
sph00640  Propanoate metabolism
sph00650  Butanoate metabolism
sph00900  Terpenoid backbone biosynthesis
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01120  Microbial metabolism in diverse environments
sph01130  Biosynthesis of antibiotics
sph01200  Carbon metabolism
sph01212  Fatty acid metabolism
sph02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS10270_Spy0121
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS10270_Spy0121
   00640 Propanoate metabolism
    MGAS10270_Spy0121
   00650 Butanoate metabolism
    MGAS10270_Spy0121
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS10270_Spy0121
   00072 Synthesis and degradation of ketone bodies
    MGAS10270_Spy0121
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS10270_Spy0121
   00310 Lysine degradation
    MGAS10270_Spy0121
   00380 Tryptophan metabolism
    MGAS10270_Spy0121
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS10270_Spy0121
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS10270_Spy0121
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGAS10270_Spy0121
Enzymes [BR:sph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS10270_Spy0121
Exosome [BR:sph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS10270_Spy0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABF33186
UniProt: Q1JIY7
Position
135096..136280
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttgtcagccgtagatttgggtgtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcactaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagttggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcggcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system