KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0409Help
Entry
MGAS10270_Spy0409 CDS       T00355                                 

Gene name
fpg
Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sph03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402977..403804
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETVRRGLEALVLGQEIVAVTLKVPKMVKTDLETFALTLPGQIIQSVGRRGKYL
LIDLGQLVLVSHLRMEGKYLLFPDEVPDNKHFHVFFELKNGSTLVYQDVRKFGTFDLIAK
SQLSAFFAKRKLGPEPKKETFKLKTFETALLSSQKPIKPHLLDQTLVAGLGNIYVDEVLW
VAKVHPETASSRLNKAEIKRLHDETIRILALGIEKGGSTVRTYRNALGADGTMQDYLQVY
GQTGKPCPRCGQAIVKLKVGGRGTHICPKCQKKRP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccagaagttgaaacggtccgacgagggcttgaggctttagtgcttggc
caagaaattgtggctgttacgcttaaagtgccaaaaatggttaaaaccgacttagagacg
tttgccctgaccctacctggtcaaatcattcagtcagttggccgtcggggaaaatattta
ttaattgatttggggcaattagtgttggtatcacatttgcggatggaaggcaaatatttg
ctttttccagatgaggtccctgataacaaacactttcatgtcttttttgaattgaaaaat
ggttcgaccttggtttaccaagatgtgcgtaaatttggaacctttgatttgatagcaaaa
tctcaattatcagcgttttttgccaaacgaaaactaggccctgaaccaaagaaagagacc
tttaagttaaaaacctttgagactgctctgctatcctcccaaaaacccataaaaccacat
cttttagaccagaccttggttgctggtttagggaatatttatgtggacgaggtactttgg
gttgctaaggttcatccagaaactgcgtcttctaggttgaataaggcggagataaaacgg
ctgcatgatgaaaccatacgaatcctagctttaggaattgaaaagggcggttcgaccgtc
cgtacttaccgtaatgctttgggagctgatggcaccatgcaggactatttgcaggtttat
ggtcaaactgggaaaccgtgtcctcgttgtggacaggctattgtcaaattaaaagttgga
ggaagggggacgcacatttgtccaaaatgccagaaaaaaagaccatga

DBGET integrated database retrieval system