KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0497Help
Entry
MGAS10270_Spy0497 CDS       T00355                                 

Definition
Glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MGAS10270_Spy0497
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MGAS10270_Spy0497
Enzymes [BR:sph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MGAS10270_Spy0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484175..484699)
Genome map
AA seq 174 aa AA seqDB search
MIPLTKLSVTPRRCHMPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQAL
QALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADP
LFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgataccgttgaccaaattatcagttacaccgaggagatgtcacatgcctaatctctat
gattttacggttaaggctcaggacggcagtgacatctcactagttaactacaaagaaaaa
gtggttttggtcgtgaatacagctaccaaatgtgggctaaccccacaataccaggccttg
caagcactatatgacacataccatgacaagggatttgaggtcttagattttccttgcaac
caatttttaaatcaagctccaggagatgctgaggagattaatcacttttgcagtctgacc
tatcacactactttccctcgctttgcaaaaatcaaagtgaatggtaaagacgctgatcct
ttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaacgcatcgaatggaat
ttcactaaatttctcattgaccaaaatggtcaagtcattaaacgctattcctcaaagaca
gatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system