KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0639Help
Entry
MGAS10270_Spy0639 CDS       T00355                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sph00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sph00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
613635..614906
Genome map
AA seq 423 aa AA seqDB search
MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRNVPILSDVFTMNNVVR
GLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGVTHLRGVEHDVVQDRIEAG
TFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEEYGIRVQANTPKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLEEMRRMGLQSEILRETAMIHG
GRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHLDRGYYQFHEKLAKLGATISRS
SEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaataatcattgaaggtggtcaaacacgcttagaaggagaagttgttattgag
ggtgctaaaaacgcagttcttcctttactggcagcatctattttaccttcaaaaggaaaa
acaattcttagaaacgttcctattctatctgatgtttttactatgaataacgtggtacgt
ggtttagatattcgtgttgattttaatgaagcagctaacgaaatcacagttgatgcctca
ggacacattttagatgaagccccttacgagtacgtgagccaaatgcgtgcctctattgtt
gttttaggaccaattttggcacgtaatggccacgcaaaagtatcaatgcctggaggctgt
acgattggcagtaggcctattaatttgcacttaaaaggattagaggctatgggggcaacg
attactcaaaaaggtggagatattaccgctcaagcagatcgactgcaaggtgccatgatt
tatatggacttcccatctgtaggagctacccaaaacttaatgatggctgccactttagct
gatggtgtgaccactattgaaaatgctgctcgtgagcctgaaattgttgatttagctcaa
tttttgaataaaatgggagctagaattcgtggtgctggaacagagacgttaacgataaca
ggcgtcacgcatttacgaggcgtagaacatgatgttgttcaagatcgtatagaagccggt
acatttatggttgcagcggcgatgacttcaggcaatgttttgattagagatgctgtttgg
gaacataatcgtccattgatttcaaaattaatggaaatgggtgtttctgtaacagaagaa
gaatacggtattcgcgttcaagcaaacacaccaaagctcaaacctgtaacggttaaaacc
ttgcctcatccgggttttccaacagacatgcaagctcaatttacagctttaatggcagtg
gtcaatggagagtctactatggttgaaactgtctttgaaaatcgatttcaacatctggaa
gaaatgcgacgcatgggcttacaatctgaaatccttagggaaactgccatgattcatggt
ggaagacaactgcaaggtgctcctgtgatgtcaacagatttacgtgccagtgctgccctt
atcttgacagggattgttgctcaaggagtgacaatagttaataatttggttcatttagat
cgtggctactatcaatttcatgaaaaattagcaaagcttggagctactattagtcgtagc
agtgaggtctag

DBGET integrated database retrieval system