KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0699Help
Entry
MGAS10270_Spy0699 CDS       T00355                                 

Gene name
pyrB
Definition
Aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sph00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sph00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675493..676482
Genome map
AA seq 329 aa AA seqDB search
MLLDHLHSHQSLVIKGIIMSVVNNRVALTNLVSMEALTTEEVLGLINRGSEYKAGKVVIS
DHQKDLVANLFFENSTRTHKSFEVAEKKLGLTVLDFNADASAVNKGESLYDTVLTMSALG
TDICVIRHPEDDYYKELVESPTITASIVNGGDGSGQHPSQCLLDLLTIYEEFGRFEGLKI
AIAGDLTHSRVAKSNMQILKRLGAELYFYGPEEWYSEAFNAYGTYIAIDQIIKELDVLML
LRVQHERHDGHQSFSKEGYHQAFGLTQERYQQLKDSAIIMHPAPVNRDVEIADSLVEAPK
ARIVSQMANGVFVRMAIIEAILNGRNKNS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttagaccacttacatagtcatcagtcgttagtgataaaggggataatcatgtca
gttgtaaataatcgcgttgcacttactaatttagtttcaatggaagcattaaccaccgaa
gaagttttaggtcttatcaaccgtggttcagaatacaaggctggtaaggttgttatttcg
gatcatcaaaaggatcttgttgccaatttattctttgaaaactccacccgaacccataag
tcttttgaagtggctgagaagaaactcggcttgacagttcttgatttcaatgctgatgca
agtgcggttaacaagggagaaagtttgtatgatactgtgttaaccatgagtgcacttgga
acagacatctgtgtgattcgtcacccagaagatgattattacaaggaattagtagaaagt
ccaactattacagcttccattgtcaatggaggagatggttctggacaacacccgagtcaa
tgtttacttgacttattaaccatctatgaagaatttggacgctttgaaggcttaaagatt
gcgatcgctggtgacttaactcactctagggtggcaaagtccaacatgcaaatcctcaaa
agattaggagcagagctttatttctatggacctgaagaatggtattcagaagcctttaat
gcttacggcacttatattgctattgaccagattattaaggaattggatgttcttatgttg
ctgcgtgtacagcacgaacgtcatgacggccatcagagtttttcaaaagaaggttaccat
caagcgtttggattgacacaggaacgttaccaacaattaaaagattctgctattattatg
catccagctccagttaatcgggatgtggaaattgcagatagtttggtggaagctcctaaa
gcgagaattgtatctcagatggctaatggtgtctttgttcgcatggctattattgaagcc
attttgaatggtagaaataaaaactcatga

DBGET integrated database retrieval system