KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0722Help
Entry
MGAS10270_Spy0722 CDS       T00355                                 

Gene name
mur1-1
Definition
N-acetylmuramidase (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701691..702290
Genome map
AA seq 199 aa AA seqDB search
MKVKKRRRRAKSSVNQLVLGLVLLNLIVSMWTLKLGNQRLAPYADHETLTFVRKISHAAQ
SVAQKKQLYSSVMMAQAILESNNGKSQLSQKPYYNFFGIKGSYKERSVIFPTLEDDGQGN
LYQIDAAFRSYGSLTACFLDYARVLNDPLYDKTHKKFWSHYQDATATLTGTYATDTTYHT
KLNELIEWYQLTNFDGLMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtgaaaaaaaggagaagaagggctaaatcatcagtaaatcaacttgtcttaggg
ttagtattacttaatctgattgttagtatgtggacactaaaattgggaaaccagcgatta
gctccgtatgcggatcacgaaactctgacatttgtcaggaagattagtcatgctgctcaa
tcagtcgctcaaaagaaacagttatacagttcggtgatgatggctcaggccattttagaa
tccaataatggcaagtcacaactaagtcaaaaaccttattataattttttcgggattaag
gggagctataaagaacggtcagtcatttttccaactttagaagacgatggacaagggaat
ctttatcaaattgatgctgcttttcgttcctatgggagcctgacagcttgttttttagat
tacgcaagagttttgaatgatccactttatgacaaaacccacaaaaagttttggtctcat
tatcaagatgctactgcaaccttaacaggcacttacgccactgatacaacttaccatacc
aaattaaatgaattgattgaatggtatcaactcactaattttgatggtctaatgaaatag

DBGET integrated database retrieval system