KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0938Help
Entry
MGAS10270_Spy0938 CDS       T00355                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00790  Folate biosynthesis
sph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS10270_Spy0938 (folP)
Enzymes [BR:sph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MGAS10270_Spy0938 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABF34003
UniProt: Q1JGZ1
Position
891882..892682
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFG
FAKSVQQNTELLKGLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcat
gttgagcaaatgattgctgatggggctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgaccgggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacagaatacggagttattaaaaggattggaccgcgtctgtcag
ttgggctatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

DBGET integrated database retrieval system