KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy0940Help
Entry
MGAS10270_Spy0940 CDS       T00355                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS10270_Spy0940 (folK)
Enzymes [BR:sph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MGAS10270_Spy0940 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893045..893545
Genome map
AA seq 166 aa AA seqDB search
MTIVYLSLGTNMGDRAAYLQKALEALADLPQTRLLAQSSIYETTAWGKTGQADFLNMACQ
LDTQLTAADFLKETQAIEQSLGRVRHEKWGSRTIDIDILLFGEEVYDTKELKVPHPYMTE
RAFVLIPLLELQPDLKLPPNHKLLRDYLAALDQSDITLFSAQQTEF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgtttatttaagtttaggcaccaatatgggggaccgagcagcttacttgcaa
aaagctcttgaggctttagctgacttacctcaaacacggttgcttgctcaatcatccatt
tatgaaacgactgcttggggcaagacaggccaggctgattttctcaatatggcctgtcaa
ttagatacacaattaaccgcggctgatttcttaaaagaaacacaagctattgagcaatct
cttggtcgtgtgaggcatgaaaaatggggatcaagaactattgacattgatatcttgcta
tttggagaagaggtttatgacacaaaggaattgaaagtgccacacccttatatgactgag
cgtgcttttgttttaatccccttattggaattgcagccagatttaaaattgcctcctaat
cataagcttttaagggattatcttgcagctttagatcaatcagatatcacgctcttttca
gctcaacagacagagttctag

DBGET integrated database retrieval system