KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1112Help
Entry
MGAS10270_Spy1112 CDS       T00355                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGAS10270_Spy1112 (malM)
Enzymes [BR:sph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MGAS10270_Spy1112 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1062167..1063660)
Genome map
AA seq 497 aa AA seqDB search
MNKRASGILMHISSLPGKFGIGTFGKSAFEFVDFLAETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFELLVADGYLQEADLVGVDFGSDPEVVDYAQIFQARRPLLEKAVQAFL
ATKEGIKELAAFEAEASWLGDFAEFMSLKEHFQNKALQEWDDRAIVKREEAALHHYRELL
AKKITYHKVCQYFFYQQWSALKIYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
KPLFIAGVPADGFSEDGQLWGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGF
SDFWEIPAGDKTARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEEQVHFVNNYLH
KHADESITKAMLRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQ
DHKDYLIYLTDLYGRAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgcaagcggtatcttaatgcatattagttccctgcctgggaaatttggg
ataggcacttttggaaaatcagcttttgaatttgttgattttctagcagagacgaaacaa
acctattggcaaattctgcctttaacaacgacgagttttggagattctccttatcagtca
ttttcagctattgctgggaacacacatttcattgattttgaattacttgttgcagacggc
tacttgcaagaagctgatctcgttggcgttgattttggttctgaccctgaggtggttgac
tatgctcagatttttcaggcaagacgccccttattagaaaaagcggtccaagcctttctt
gcaactaaagaaggcatcaaagaattggcagcttttgaagcagaagcgagttggttgggt
gactttgccgagttcatgtcattgaaagaacactttcaaaataaggccctacaagaatgg
gatgacagagcaattgtgaaacgcgaagaagcagccttgcatcattaccgtgagttgctt
gcaaaaaagattacctatcataaagtctgtcaatacttcttttaccaacaatggtcagcc
ttgaaaatttacgctaaccataaagggatagaaattattggtgatatgcctatttatgtt
tctgcggacagtgtagaagtttggacgatgcctgagctatttaaagtagatagtgataaa
aagccattgtttattgcaggtgtaccagcagatggctttagtgaagatggtcagctgtgg
ggaaatccaacctacaattggtctgctcatgaaaagtctaattttgcatggtggatttat
cgtattcaagaaagttttaaactatatgatcagctaagaatcgatcattttaaaggcttc
tcagatttttgggaaattcctgctggtgataaaactgctagaaatggccattgggcctca
gccccaggtatagcattattttctgcggttcgtgaggccttaggagagcttcctatcatc
gcagaaaaccttggttatattgatgaaaaagcagagcagctattagcatcaacaggcttt
cctggcatgaagatattagaatttggtttatttgatataacgagtcaaagtatagattta
ccacattactatgaccgtaattgtgtcgcttacacagggactcatgataacgaggtggtt
aacggatggtatgacaatcttagtgaagaacaagtacactttgtaaataactatcttcac
aaacatgcagatgaaagtattacaaaagccatgctaagaacaatctttgcttctgtttgt
gatacagccattctttgcatccaagatttattagataaagatggtaagagtcgtatgaat
atgccaaatacaattggaggtaattggcaatggcgtatgcttgacggtgaattgaaccaa
gatcacaaagattaccttatttatttaacagatctttatggtcgcgcaagataa

DBGET integrated database retrieval system