KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1121Help
Entry
MGAS10270_Spy1121 CDS       T00355                                 

Gene name
amyA
Definition
Cyclodextrin glucanotransferase (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1072872..1075058)
Genome map
AA seq 728 aa AA seqDB search
MDILCLVTKRLFEKEKAMRELHIKTYKLLTKSAVLLGLISFPLTVSAADNASVTNKADFS
TDTIYQIVTDRFNDGNTSNNGKTDVFDKNDLKKYHGGDWQGIIAKIKDGYLTDMGISAIW
ISSPVENIDSIDPSNGSAAYHGYWAKDFFKTNQHFGTEADFQQLVKVAHQHHIKVVIDFA
PNHTSTAEKEGTTFKEDGALYKNGKLVGKFSDDKDKIFNHESWTDFSTYENSIYHSMYGL
ADLNNINPKVDQYMKEAIDKWLDLGVDGIRVDAVKHMSQGWQKNWLSHIYEKHNVFVFGE
WFSGHTDDDYDMTTFANNSGMGLLDFRFANAIRQLYTGFSTFTMRDFYKVLENRDQVTNE
VTDQVTFIDNHDMERFATKVANNQTAVNQAYALLLTSRGVPNIYYGTEQYATGDKDPNNR
GDMPSFNKESQAYKVISKLAPLRKQNQALAYGTTEQRWISDHVLVFERKFGNHVALVAIN
RDQTNGYTITNAKTALPQNSYKDKLEGLLGGQELIVGADGTISSFELGAGQVAVWTYEGE
DKTPQLGDVDASVGIAGNKITISGQGFGNSKGQVTFGEISAEILSWSDTLITLKVPTVPA
NYYNISVTTADKQTSNSYQAFEVLTDKQIPVRLLINDFKTVPGEQLYLMGDVFEMGANDA
KNAVGPLFNNTQTIAKYPNWFFDTHLPINKEIAVKLVKKDSIGNVLWTSPETYSIKTGHE
AQTITIKK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggatatattgtgtttagtaactaaaaggttatttgaaaaggaaaaagcgatgagagaa
ttacatatcaaaacttataagttattaacgaaaagtgctgttttacttggcttaatttca
tttccactaactgtttctgctgccgataatgcttctgtcaccaacaaagcagatttttca
acagatacgatttatcagattgtaacagatcgttttaacgatggtaatacctctaataat
ggtaagactgatgtttttgataaaaatgaccttaaaaaataccatggaggtgattggcaa
ggaatcatcgccaagattaaggatggttacctgacagatatggggatttctgccatttgg
atttcttctcctgttgaaaatatcgacagtattgatccttctaatggaagtgctgcatat
catgggtattgggctaaggacttctttaaaacaaaccagcattttggcactgaagcagac
tttcaacaactagtcaaagtagctcatcaacaccatattaaggtagttattgattttgct
cctaatcatacgtctacagccgaaaaagaaggcacaactttcaaagaagatggcgcttta
tataaaaacggtaaattagttggtaaattttcagatgataaagacaagatttttaatcat
gaatcttggaccgattttagtacttatgaaaattctatttatcattcaatgtacggacta
gctgatttaaataacattaatccgaaagttgaccagtacatgaaagaagctattgataaa
tggttagacctgggtgttgatggtatccgagttgacgctgttaaacatatgtcacaaggt
tggcaaaaaaattggttgagtcatatctatgaaaaacataatgtctttgttttcggggaa
tggttctcgggacataccgacgatgattatgatatgacgacatttgctaacaatagtggg
atggggcttttagattttagatttgccaatgctattagacagttgtatacaggtttttca
acgtttaccatgcgagatttttacaaggttcttgaaaatagagatcaggtgactaatgaa
gtgacagaccaggtgacctttattgataatcatgatatggaacgcttcgcaacaaaagtg
gctaataatcaaactgctgttaatcaagcctatgctttgcttttaacatctagaggtgtg
cctaatatttattatggtacagagcagtatgcaacaggtgataaagatcctaataatcgt
ggtgatatgccaagttttaataaagagtcacaagcctataaagtgattagtaagctagct
cctttaagaaaacaaaatcaagctttagcttatggaacaactgaacaacgttggattagt
gatcatgttttggtatttgagcgtaaatttggtaatcatgtcgcactagtggctattaat
agagatcaaacgaatggttatacaattactaatgctaaaacagccttgccccaaaatagc
tacaaggacaaattagaaggtcttcttggcggtcaagaattaatagttggagcagatggc
actattagtagctttgaacttggagcggggcaagtcgctgtatggacttatgaaggagag
gacaagacaccacaacttggagatgtcgatgcttcagtgggtattgctggaaataagatt
actatttcaggtcaaggttttggtaattctaaaggtcaagtgacttttggagaaatctct
gctgagatcctttcttggtcagatacccttatcaccttaaaagtaccgacggttccagca
aattattataacatttcagtgacaactgccgataagcaaaccagcaatagttaccaagcc
tttgaagtattgactgataaacaaattcctgttcgtttactcatcaatgattttaagaca
gtaccaggggaacaactatatctcatgggtgatgtttttgagatgggggcaaatgacgct
aagaatgctgttggtcctctatttaataacactcagaccattgccaagtacccaaactgg
ttctttgatactcatctaccaatcaataaagaaatagcagtcaaacttgttaaaaaagat
agtattgggaatgttttatggacaagtcctgagacttatagtataaagacaggtcatgaa
gcacaaaccattactataaaaaaataa

DBGET integrated database retrieval system