KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1164Help
Entry
MGAS10270_Spy1164 CDS       T00355                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sph00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sph00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1117151..1117606)
Genome map
AA seq 151 aa AA seqDB search
MLRGGKGGIMSANDQVVGNLKQALEARGYEVTINDGTTRVKGEILAYRNDVDLALTVVNV
VDYEAQNNYRIQWETAMFNEVPWYVYEVPTVFISLNYKTHLHDATMVKTAINAYHHNTNT
IAALLDCLEGKAAFKGQPNELVWANKWQAKL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagaggggggaaaggaggaattatgagtgccaatgatcaagtggtcggaaacctt
aaacaggccctagaggcaagaggttacgaggtgacgattaatgatggcacgactcgcgtc
aagggagagatcttggcctatcgtaatgacgtggatttggccttgacggtggtcaatgtt
gttgactatgaagctcaaaataattaccgtatccaatgggagacagccatgtttaatgag
gtgccttggtacgtttatgaagttccaactgtctttatttcccttaattacaagacgcat
ctgcacgatgccactatggtcaaaacagcgattaatgcttatcaccataatactaatacg
attgcagcccttttggattgtctagaaggcaaagcagcttttaaaggccaacctaatgag
ttagtttgggccaataagtggcaagccaagctgtaa

DBGET integrated database retrieval system