KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1230Help
Entry
MGAS10270_Spy1230 CDS       T00355                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sph03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1188331..1188927)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSNEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDTSRDQTTILVVEDAKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMDGKVSEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttatccaacacccattgcaaagttaattgacagttactctaaacttccaggaatt
ggtatcaagacggcgacgagattagccttttatactattggaatgtcaaatgaagatgtc
aatgattttgctaaaaacttattagcagctaaaagagaactgacctattgttcgatttgt
ggaaaccttaccgatgacgatccttgtcacatttgcacagacacgagtcgtgatcagacg
accattctggtagtagaagatgctaaagatgtttctgccatggaaaaaatccaagagtat
catggctattatcatgtgcttcacggcttgatttcgcctatgaatggtgtggggccagat
gacatcaaccttaaaagtttaattacccgtctaatggatggtaaggtgagcgaagttatc
gtagctaccaatgccacagcagatggggaagcaacgtccatgtatatttcacgtgtcttg
aaaccagccgggattaaggtaactcgtttggcaagaggtctcgcagtaggttcagatatt
gagtatgctgatgaagtaacattattgagagctattgagaatcgtactgaactttaa

DBGET integrated database retrieval system