KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1235Help
Entry
MGAS10270_Spy1235 CDS       T00355                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
sph00010  Glycolysis / Gluconeogenesis
sph00260  Glycine, serine and threonine metabolism
sph00680  Methane metabolism
sph01100  Metabolic pathways
sph01110  Biosynthesis of secondary metabolites
sph01120  Microbial metabolism in diverse environments
sph01130  Biosynthesis of antibiotics
sph01200  Carbon metabolism
sph01230  Biosynthesis of amino acids
Module
sph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sph_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10270_Spy1235 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MGAS10270_Spy1235 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGAS10270_Spy1235 (gpmA)
Enzymes [BR:sph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MGAS10270_Spy1235 (gpmA)
Membrane trafficking [BR:sph04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MGAS10270_Spy1235 (gpmA)
Exosome [BR:sph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MGAS10270_Spy1235 (gpmA)
  Exosomal proteins of melanoma cells
   MGAS10270_Spy1235 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF34300
UniProt: Q1JG44
Position
complement(1191960..1192655)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggt
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system