KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1419Help
Entry
MGAS10270_Spy1419 CDS       T00355                                 

Gene name
lacZ
Definition
Beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MGAS10270_Spy1419 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    MGAS10270_Spy1419 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MGAS10270_Spy1419 (lacZ)
Enzymes [BR:sph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MGAS10270_Spy1419 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1352176..1355682)
Genome map
AA seq 1168 aa AA seqDB search
MVYRQKSSEIVTRTITKPSRATSNIKQEIDMTPDSKEQTVTGYQYHYIDQEGRKQPFNQG
WRFLMADVACAQAPSFDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVL
DEVLAGCHVAITFEGSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVTFGAENLLAVRVE
NKVPSSRWYSGSGLYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQSI
QTCHYQLSLCLWEQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHL
YDLELTLYYQGQVIDCFCLETGFRQLTFMANQGLFVNGRAVKLKGVCLHHDQGGLGACAY
EDALARQLVLLKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDF
SNYFHQTIGTENANYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSAD
VSHYPELTRQMCQWITAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIG
LNYANGKDYDKLHEEHSDWLLYGSETASAITSRAYYKETKKVLDSSYHLTSYDHAKVDWG
AFASQAWYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAG
FPKDSYYFYQSQWAQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGN
LTDYGRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKS
IPKTSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSRGELVSHAQDWLKVQV
EGPARLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKASQQLSSVFQ
TQVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKITQFLSVLENKDTQQKAGKAS
TPHILITSYQHYLPLPLQVCSQAFDFKKGDDIFLPQWLQVKDAQGSFVKKAFSMTWYLKE
KIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLAASQKRLTYCYQY
DTVQAIGAISLQNHTGTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDILTV
LYLAVTLEVIEGPDLTEDSIQIGLWDLA
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcgccaaaagagttcagagatcgttacaaggacaattaccaagccatcaagg
gcgaccagtaacattaaacaggagattgatatgacaccagatagcaaggagcagacagtg
actggctaccaataccactatattgatcaagaaggaagaaagcagccctttaatcaaggc
tggcgttttcttatggcagatgtggcgtgtgctcaggccccttcttttgatgattcgaac
tggcaggtgattcatttaccacatgatttcagtcttacgcagccttacacaagaaatggt
gaagctgaaagtgcttataaattaggtggtgtcggttggtatcggcattatctcgtgtta
gatgaggttttagctggttgtcatgttgccattacttttgagggttcctatatggaaacg
gaaatttatgttaatgggcaattcattggcaaacacttaaatggctatcaggaatttacc
tatgatatctctgatgtagtgacttttggagctgaaaatcttctggctgtccgggttgaa
aacaaggttcccagttctcgttggtattcaggcagtggtctttatcgtgaagtgagtttg
tctgttcttccccagcttcattttgtggcagaccaggtagcaatgaccttggctgatact
gctgtgcaggagaaagggcaacagaaagttgatttacgctttgcccttaatcagtctatt
cagacttgccactaccaattgagcctctgtttatgggaacaatcacattgctcaaaagac
aaaaaactcctttatcaagaaacagaagtgcctctagctgatttggctttccaaagacag
tatggtcttacactgtctttggaagaactccaattgtggtcaccagataatcctcacctc
tacgatttagaactcactctttactatcaaggtcaggtcattgattgcttttgccttgaa
actggttttcgtcagctgacttttatggccaatcaggggctttttgtgaatggcagagct
gtcaaattaaagggagtttgtttgcatcatgaccaaggaggcctaggagcttgtgcttac
gaagatgccctagccagacaattagtcctgttgaaagacatgggggctaataccattcgt
agcacccataacccaagtagtcccaaacttaggcaactagccaatcgtctcggctttttt
gtgattgaagaagcctttgacacctggacctatgccaaaaatggaaacgttaatgacttt
tcaaactatttccatcagactatcggaactgaaaatgcaaactatcttcaaagagtgagg
tcacctgaaacgagctgggcccagtatagtattgaggccatggtctggtctgccaagaat
gacccgtcagtgttgatgtggtcgattggtaatgaattgatggaaggtttttcagccgat
gtcagtcattacccagagctgacaagacaaatgtgccaatggattactgctattgacacc
tcacgtcccattacctttggggacaataaattaaaagaagctgacttttgctggcatgag
gaagtgtcgcaaatggcaactcttcttagtcaattagaccatccccagggactcattggg
ttaaactatgctaatggaaaagactatgataagcttcatgaggagcactctgattggctg
ttgtatggttctgaaacagcctcagccattaccagcagggcttattataaagagacaaaa
aaagttcttgattccagttatcacctaacctcttatgatcatgctaaggttgattggggt
gccttcgctagccaggcttggtatgataccattacccgtgattttgttgctggcgaatgc
gtttggacaggctttgattatttaggagaacctacaccctggaacaagatcgacagcggt
gttgtaggcctttggccttctcctaaaaatgcctactttggcattttagacacggcaggc
tttccaaaagatagctattatttttaccaaagtcagtgggcgcaggggcagacaaccttg
cacctgttaccagtctggcagaaggaccagctttgtttcgatgagcagggattggtggag
gttgtggtttatagcaatgctgccagtgtgcaactgatgtttgaagatgagcagggcaac
ttaacagattatggaaggaaggcatttcatacttatagcacgccaacgggacacacttat
cagctttaccaaggagctgacgctgctaagaatcctcacgagaacctttacctgacttgg
cgagtgccctatcaaaaagggttgctaagggcagtggcctacgacatttctggtaaaagc
attccaaaaaccagtggacgttctcaggttagaacctatggttcagtggcaaagctatct
tggaaagcctttgaagcacctattgacgctccttgggaattgctttatctggatttatca
ctcttggatagccgaggtgaattggtcagccatgctcaagattggctaaaggttcaagta
gaaggaccagcccgtttgttggctcttgataatgggaatccgactgaccacaccccttat
caggagcctctacgccaggcatatgggggaaaattattagccattttagccctcactgga
gaggcgggacacattaaggtcacggcaaaagcctcgcagcaacttagcagtgtttttcag
acacaagtagcctgccgtgcccccaaagaacacttagtgacactacctttagagaaatat
cagtttaaaaagagccgactgacaagtcaacaagaaattggtcaatcttgtctaaagatc
acacaattcctttctgttttggagaacaaagacacccagcaaaaagcaggtaaggctagc
acacctcacattcttatcaccagttaccagcactatttacctctgcccttgcaggtttgt
tctcaggcatttgattttaaaaaaggcgatgatatcttcttgcctcagtggctccaagtc
aaagatgcccaaggttcttttgtgaaaaaagctttttcaatgacgtggtacctaaaagag
aaaatctttgccaagcctattcttgtcacgggctatgtttcttgttttgggcaatcaata
ccggttgaggcaaggctcaacctagcacaagctagcaaaagacggcaccaggatctcagt
ttagtcgccaagcaatccctggccgcaagtcaaaaaaggctaacttattgctaccaatat
gatacggtgcaagccataggagccattagcttgcaaaatcacacaggcacatctcttagt
gtttctgtggcaatcagttatggtagtcagagctctattaagcaagaaaccttgatgcta
gctgatagccacttgagccagttagaagaggttattttcttcgatgatattttgactgtt
ttgtatctggcagtgacccttgaagtcattgaaggacctgacctaactgaagacagtatt
caaattggcctttgggatttagcatga

DBGET integrated database retrieval system