KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1427Help
Entry
MGAS10270_Spy1427 CDS       T00355                                 

Definition
Glucokinase / transcription regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:sph01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sph00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sph00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sph00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sph00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sph00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1363283..1364206
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCLDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAVSAPGAVNKEKGIIEGASAIPYIHHFKIQEVLEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDHLAIKERQVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactataataaaggagaacacctcatgagcttgttatgt
cttgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccgttagtgctcctggagcggtt
aacaaggaaaaaggtattatcgaaggtgccagcgctattccctacattcaccattttaaa
atacaagaggtcttagaagaacggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccacctagcaatc
aaagaaaggcaggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagctatttgtcactttaaaaacgaagccaatcttcttggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system