KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1498Help
Entry
MGAS10270_Spy1498 CDS       T00355                                 

Gene name
glpO
Definition
Alpha-glycerophosphate oxidase (EC:1.1.3.21)
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MGAS10270_Spy1498 (glpO)
Enzymes [BR:sph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     MGAS10270_Spy1498 (glpO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1445124..1446962)
Genome map
AA seq 612 aa AA seqDB search
MEFSRETRRLALQKMQERDLDLLIIGGGITGAGVALQATASGLDTGLIEMQDFAQGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKAEDFLLDDNGKIIGVKARDLLTDQEIIIKAKLVINTTGPWSDEI
RQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFDR
DENGLFTLAGGKITDYRKMAEGALTGIIQTLKEEFGKSFKLINSKTYPVSGGEINPANVD
SEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLTAAEGLSLAETLSLHYAMD
YEMTLKPTDYFLRRTNHLLFMRDSLDALIDPVTNEMAKHFEWSDQERVAQEDDLRRVIAD
NDLSALKGHQEG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaagagaaacaagacgcttagctctccaaaaaatgcaagaaagagattta
gacctactgattattgggggaggtattacgggtgctggtgtggcacttcaggcgacagct
agtggcctagatacgggtctgattgagatgcaagattttgcgcaaggaacctctagccgt
tcaaccaaattggttcacggggggcttcgttacttgaaacaatttgatgtggaggtggtt
tcagatacggtgtcagagcgggctgtggtgcaacaaattgcaccacacattccaaaacca
gaccctatgttattacctgtttatgacgaacctggtagtacctttagcatgttccgtttg
aaggtcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaaccaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcctg
cttggtggtggggtttaccttgatttccgtaataatgatgcaaggcttgttattgaaaat
atcaaacgagctaatcgtgatggggctcttattgctagtcatgtgaaagcagaagatttc
ttgctagatgacaatggtaagattatcggtgttaaggcgcgtgatttattaacagatcaa
gaaatcatcatcaaggctaaattggtcatcaataccacaggaccatggagtgatgagatt
cgtcaattctctcataagggacaaccgattcatcaaatgcgccctacaaaaggggtgcat
ctggtagtggaccgtcaaaaattaccagtgtctcaacctgtctatgttgacacagggtta
aatgatggtcgtatggtctttgtcttgccacgtgaagaaaaaacttattttggaacaacg
gacacggactacactggagacttggagcacccacaagttactcaagaagatgtggattat
ttgttaggcgttgtcaataaccgctttccaaatgccaacgtgaccattgatgatattgaa
agcagttgggctggtcttcgccccttgttatcaggtaatagtgcttctgactacaatggt
ggcaacagcggtaaagtcagtgatgatagttttgatcacttggttgatactgtcaaagcc
tatattaaccacgaagatagccgagaagctgttgaaaaagctattaagcaggttgaaacc
agcacatctgaaaaagaattggatccgtctgcagtgtcacgaggttcaagttttgaccgt
gatgagaatggactctttaccttggcaggtggtaagattaccgactatcgcaaaatggct
gaaggagcattgacagggattattcaaaccctcaaagaagagtttggcaaatccttcaag
cttatcaattcaaaaacctatcctgtttcaggaggtgaaatcaatccagccaatgtagat
tcagaaatagaagcctatgctcaattaggaactcttagtggtctttcgatggatgatgct
aggtatttggcaaacctttatggttctaatgcgccaaaagtctttgccttaactcgtcaa
ttaacagcagctgaagggttaagtttagctgaaaccttgtccttacattatgcgatggat
tatgaaatgacccttaaaccgacagattatttcttgagaagaacaaatcacctcttattt
atgcgagatagcctagatgctttgattgacccagtgactaatgaaatggctaaacatttt
gaatggtctgatcaggaaagagtggcacaagaagacgatcttcgtcgcgtgattgcagac
aatgatttgagtgccttaaaaggccatcaggagggttaa

DBGET integrated database retrieval system