KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1499Help
Entry
MGAS10270_Spy1499 CDS       T00355                                 

Gene name
glpK
Definition
Glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sph00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1446978..1448504)
Genome map
AA seq 508 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGWVEHNANQIWNSVQSV
IAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVWQSRQTAPIAEQLKQDG
HTKMIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGAVH
VTDYSNAARTMLYNIKDLTWDDEILELLNIPKDMLPEVKSNSEIYGKTAAFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGINGKVH
YALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDSN
ARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNMLM
QFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDMDALKELNATGQLFKASMNESRK
EKLYKGWKRAVKATQVFTQEEDADDDAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagaaaagtatatcatggctattgatcagggaacaacaagttcacgagcgatt
attttcaatcaaaaaggggaaaaggttagcagtagccaaaaagaattccctcagattttc
ccacacgctggttgggtagagcacaatgctaatcagatttggaattcggttcagtctgtt
attgcgggtgcttttattgagtccagcatcaaaccaagccaaattgaagcaatcggaatt
accaaccaacgtgagaccacagtggtttgggacaaaaaaacgggtgtacctatttataat
gctattgtgtggcaatcacggcagacggcaccaattgctgagcaactcaaacaagatggc
catacaaaaatgatccatgaaaagacaggccttgttattgatgcttacttttctgcaacc
aagatccgttggattttggaccatgtgccaggtgctcaagaacgagctgaaaaaggcgag
ttactttttggaaccattgatacttggctggtttggaaattgacagatggtgctgttcat
gtgacggattattccaatgcggctcgtaccatgctctataatattaaagacttaacatgg
gatgatgagattttagagcttttaaatattccaaaagatatgcttccagaggttaaatcc
aattctgaaatttatggcaaaacagctgcctttcatttttatgggggcgaagtgcctatt
tcaggtatggcgggtgaccaacaggcagctttgtttggccaactagcttttgagcctggt
atggtgaaaaacacttatggcacaggttctttcattatcatgaatactggtgatgagatg
cagttatcgagtaataatcttttgaccaccattggttacgggattaatgggaaggttcac
tatgccttggaaggttccatctttattgcaggctctgctattcaatggttgcgagatggt
cttaaaatgattgagacttcaccagaatctgaacagttcgctctagcatcaactagtgac
gatgaagtttatgttgtgcctgcttttaccggtttaggagctccttactgggattctaat
gcgcgtggatctgtctttggcttgacacgtggtacaagcaaagaagattttgtcaaagca
accttacaatctatcgcctatcaagtgcgagatgttattgataccatgcaggtggattca
ggtattgacattcaacagctccgtgtggatggcggtgcagccatgaataatatgctcatg
caatttcaggctgatattttaggaattgatattgcccgtgctaaaaatttagaaacaaca
gctctaggagcagctttcttagcagggcttgctgtggggtattgggaagatatggatgct
ttgaaagagttaaatgcaacaggccagctctttaaggctagcatgaatgaatcgcgcaaa
gaaaaattatacaagggttggaagcgcgctgttaaagcaactcaagttttcacccaagaa
gaagatgcagatgacgatgcaaaataa

DBGET integrated database retrieval system