KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1671Help
Entry
MGAS10270_Spy1671 CDS       T00355                                 

Gene name
lppC
Definition
(GenBank) Acid phosphatase (EC:3.1.3.2)
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1614488..1615342)
Genome map
AA seq 284 aa AA seqDB search
MKSKKVVSVISLTLSLFLVTGCAKVDNNKSVNRKPATKQTYNSYSDDQLRSRENTMSVLW
YQRAAETQALYLQGYQLATDRLKEQLNKPTDKPYSIVLDIDETVLDNSPYQAKNVLEGTG
FTPESWDYWVQKKEAKPVAGAKDFLQFADQNGVQIYYISDRSTTQVDATMENLQKEGIPV
QGRDHLLFLEKGVKSKESRRQKVKETTNVTMLFGDNLLDFADFSKKSQEDRTALLSDLQE
EFGRRFIIFPNPMYGSWEGAIYKGEKLDVLKQLEERRKSLKSFK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaaaaaagttgttagtgttatatcacttaccttatccctttttttggtgaca
ggttgtgctaaagttgataacaacaaatcagttaatcgtaagcctgctactaaacaaacc
tataatagctatagtgatgaccaattaagatcgcgtgaaaataccatgtctgttttatgg
taccagcgagctgcggaaactcaagcgctttatttacaggggtatcagttagcaacggat
cgcttaaaagaacaactcaataaaccaacggataaaccttattcaattgtattagatatt
gacgaaacagttcttgataatagcccttatcaagctaaaaatgttttggaaggaacagga
tttacacctgaaagctgggattattgggtacaaaagaaagaagcaaaaccggttgctggt
gctaaagactttttgcaatttgcagaccaaaatggtgttcaaatttactacatttcagac
agatcaactactcaagtagatgctacaatggaaaatctccaaaaagaaggtattccagta
caaggtcgtgatcatcttctattcttagaaaaaggcgtaaaatcaaaggagagtcgtcgt
caaaaggtcaaagaaacaactaatgtaacgatgctatttggtgataatcttctagatttt
gctgatttttcaaaaaaatctcaagaagatagaacagctttattatcagatttgcaagaa
gagtttggaagacgctttatcattttccctaatcctatgtatggttcatgggaaggtgcc
atttataaaggtgaaaagctggatgtgcttaagcaactagaggaacgccgtaaaagttta
aaaagctttaaataa

DBGET integrated database retrieval system