KEGG   Streptococcus pyogenes MGAS10270 (serotype M2): MGAS10270_Spy1671Help
Entry
MGAS10270_Spy1671 CDS       T00355                                 

Gene name
lppC
Definition
Acid phosphatase (EC:3.1.3.2)
Orthology
K01078  
acid phosphatase [EC:3.1.3.2]
Organism
sph  Streptococcus pyogenes MGAS10270 (serotype M2)
Pathway
Aminobenzoate degradation
Riboflavin metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MGAS10270_Spy1671 (lppC)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MGAS10270_Spy1671 (lppC)
Enzymes [BR:sph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     MGAS10270_Spy1671 (lppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1614488..1615342)
Genome map
AA seq 284 aa AA seqDB search
MKSKKVVSVISLTLSLFLVTGCAKVDNNKSVNRKPATKQTYNSYSDDQLRSRENTMSVLW
YQRAAETQALYLQGYQLATDRLKEQLNKPTDKPYSIVLDIDETVLDNSPYQAKNVLEGTG
FTPESWDYWVQKKEAKPVAGAKDFLQFADQNGVQIYYISDRSTTQVDATMENLQKEGIPV
QGRDHLLFLEKGVKSKESRRQKVKETTNVTMLFGDNLLDFADFSKKSQEDRTALLSDLQE
EFGRRFIIFPNPMYGSWEGAIYKGEKLDVLKQLEERRKSLKSFK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaaaaaagttgttagtgttatatcacttaccttatccctttttttggtgaca
ggttgtgctaaagttgataacaacaaatcagttaatcgtaagcctgctactaaacaaacc
tataatagctatagtgatgaccaattaagatcgcgtgaaaataccatgtctgttttatgg
taccagcgagctgcggaaactcaagcgctttatttacaggggtatcagttagcaacggat
cgcttaaaagaacaactcaataaaccaacggataaaccttattcaattgtattagatatt
gacgaaacagttcttgataatagcccttatcaagctaaaaatgttttggaaggaacagga
tttacacctgaaagctgggattattgggtacaaaagaaagaagcaaaaccggttgctggt
gctaaagactttttgcaatttgcagaccaaaatggtgttcaaatttactacatttcagac
agatcaactactcaagtagatgctacaatggaaaatctccaaaaagaaggtattccagta
caaggtcgtgatcatcttctattcttagaaaaaggcgtaaaatcaaaggagagtcgtcgt
caaaaggtcaaagaaacaactaatgtaacgatgctatttggtgataatcttctagatttt
gctgatttttcaaaaaaatctcaagaagatagaacagctttattatcagatttgcaagaa
gagtttggaagacgctttatcattttccctaatcctatgtatggttcatgggaaggtgcc
atttataaaggtgaaaagctggatgtgcttaagcaactagaggaacgccgtaaaagttta
aaaagctttaaataa

DBGET integrated database retrieval system