KEGG   Sphingopyxis fribergensis: SKP52_02120Help
Entry
SKP52_02120       CDS       T03542                                 

Gene name
fadA1
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sphk  Sphingopyxis fribergensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sphk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SKP52_02120 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    SKP52_02120 (fadA1)
   00640 Propanoate metabolism
    SKP52_02120 (fadA1)
   00650 Butanoate metabolism
    SKP52_02120 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    SKP52_02120 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    SKP52_02120 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SKP52_02120 (fadA1)
   00310 Lysine degradation
    SKP52_02120 (fadA1)
   00380 Tryptophan metabolism
    SKP52_02120 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SKP52_02120 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SKP52_02120 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SKP52_02120 (fadA1)
Enzymes [BR:sphk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SKP52_02120 (fadA1)
Exosome [BR:sphk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SKP52_02120 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
481282..482451
Genome map
AA seq 389 aa AA seqDB search
MPTAYIVDAVRTAGGKRGGRLAGVHPVDLGAAVFDAIADRNDFDTKAIDDVITGCVSQGG
QQTMDVGRNAVLASKLPDSIPAVTIDRQCGSSQQAIQFAAQAVMSGTQDIVLASGIESMT
RVPMGSVATLFMKEGLGHYKSERLEEKYPGIMFSQFMGAEMIVKKYGLTKGDLDAYALES
HRRGKAATEAGHFQREIVGVEIDTPDGRQTHLVDEGIRFDATLEGIAGVKILQEGGSITA
ATSSQICDGASAALVVSEQALKDHGLTPRARIHHVSVTAGDPVIMLEEPLFATERALKRA
GMKIEDIDAYEVNEAFAPVPLAWLKYLGADHARLNQHGGAIALGHPLGASGTKLMATLLG
VLDATGGKYGLQTMCEGGGQANVTIIERL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctactgcttatatcgtcgacgccgtccgcaccgcgggcggcaagcgtggcggccgg
cttgccggtgtccaccccgtcgacctcggcgccgcggtgttcgacgcgatcgccgatcgt
aacgacttcgacacgaaggcgatcgacgacgtcatcaccggctgtgtcagccagggcgga
cagcagacgatggacgtcggccgcaacgcggtgctcgcttcgaaactgcccgactcgatc
ccagcggtaacgatcgaccgccagtgcggctcgtcgcagcaggcgatccagttcgccgcg
caggcggtgatgtcgggcacgcaggacatcgtcctggcgagcggtatcgaaagcatgacg
cgcgtcccgatgggcagcgtcgcgaccttgttcatgaaggagggcctcggccattataag
tccgagcggctcgaggaaaaatatcccggcatcatgttcagccagtttatgggcgccgag
atgatcgtcaagaaatacggcctgaccaagggcgacctcgacgcctatgcgctcgagagc
catcgccgcggcaaggcggcaaccgaggcgggccatttccagcgcgagatcgtcggcgtc
gagatcgacacgcccgacggccgtcagacccatctggtcgacgaaggcatccgcttcgac
gcgacgctcgaaggcatcgccggggtcaagatcctgcaggaaggcggctcgatcactgcg
gcgacatcgagccagatctgcgacggtgcctcggcggcgctcgttgtgtcggaacaggcg
ctcaaggatcatggcctgaccccgcgcgcgcgcattcatcatgtctcggtgaccgcgggc
gacccggtgatcatgctcgaagagccgctgttcgcgaccgaacgcgcgctgaagcgtgcg
ggcatgaagatcgaggacattgacgcctatgaggtcaacgaggcgttcgcgcccgtgccc
ctggcttggctcaaatatctcggtgccgaccatgcccggctcaaccagcatggcggcgcg
atcgcgctcggccacccgctcggcgccagcggcaccaagctgatggcgaccctgctcggc
gtgctcgacgccacgggcggcaaatatggccttcagacgatgtgcgaaggcggcggccag
gccaacgtcacgatcatcgagcggctttaa

DBGET integrated database retrieval system