KEGG   Sphingomonas sp. MM-1: G432_01850Help
Entry
G432_01850        CDS       T02498                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    G432_01850
Enzymes [BR:sphm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     G432_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(401796..402389)
Genome map
AA seq 197 aa AA seqDB search
MGEMMETPAKIAVPEDVEEAIRTLLRWAGDDPTREGLLDTPKRVARAWKEYCKGYGDDPA
RHLSRTFEEVGGYDEIVLLKDIPFQSHCEHHMAPIIGKAAIAYLPRERVVGISKLARVLH
GFARRLQVQERLTAEVADCIWDNLAPHGVAVVIEATHACMTARGVQTPGVVMTTSRMMGV
FRDDERSRAEVLKLMGY
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatgatggaaacccccgcgaagatcgcggtgccggaagacgtcgaggaggcg
atccgcaccctgctgcgctgggcgggggacgatcccacgcgcgaaggcctgctggatacg
cccaagcgcgtcgcgcgcgcgtggaaggaatattgcaagggctatggcgacgatccggcc
cgccatctgagccgcaccttcgaggaagtgggcggttatgacgagatcgtgctgctgaag
gacatccccttccagtcgcattgcgagcatcatatggcgccgatcatcggcaaggcggcg
atcgcctatctgccgcgcgagcgggtggtgggcatttccaagctcgcccgcgtgctgcac
ggcttcgcccgccggctgcaggtgcaggaacggctgacggccgaggtggcggactgcatc
tgggacaatctcgccccccatggcgtggcggtggtgatcgaggcgacgcatgcctgcatg
accgcgcgcggcgtgcagacgccgggcgtggtgatgacgaccagccggatgatgggcgtg
ttccgcgacgacgaacgatcgcgcgcggaagtgctgaagctgatgggttattga

DBGET integrated database retrieval system