KEGG   Sphingomonas sp. MM-1: G432_01980Help
Entry
G432_01980        CDS       T02498                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00360  Phenylalanine metabolism
sphm00362  Benzoate degradation
sphm00620  Pyruvate metabolism
sphm00621  Dioxin degradation
sphm00622  Xylene degradation
sphm00650  Butanoate metabolism
sphm01100  Metabolic pathways
sphm01120  Microbial metabolism in diverse environments
sphm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    G432_01980
   00650 Butanoate metabolism
    G432_01980
  Amino acid metabolism
   00360 Phenylalanine metabolism
    G432_01980
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G432_01980
   00622 Xylene degradation
    G432_01980
   00621 Dioxin degradation
    G432_01980
Enzymes [BR:sphm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     G432_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA RNase_HII
Motif
Other DBs
NCBI-ProteinID: AGH48124
UniProt: M4S0Y6
Position
complement(428036..428977)
Genome map
AA seq 313 aa AA seqDB search
MGKVKAAIIGSGNIGTDLMIKMIKYPQNMELVAVVGIDEKSEGLAMARERGVATTHEGLD
GLKAMDVYPEIGIVFDATSAYAHKVHDAALRADGKLVVDLTPAAIGPFTIPPVNMEEHLA
EGNVNMVTCGGQATIPMVAAVSQVAKVHYAEIVASVSSRSAGPGTRANIDEFTRTTASAI
EKVGGAEKGKAIIILNPAEPPMIMRDTVFTLSEGADEETIRASVKAMVAKVQEYVPGYRL
KQEVQFERFGDNNKLKIPGRGEFTGIKTSIFLEVEGAGDYLPSYSGNLDIMTAAAKATGE
LMARRLLDQKAAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaggtgaaggcggcgatcatcggttcgggcaatatcggcaccgacctgatgatc
aagatgatcaaatatccccagaatatggagctggtggctgtcgtcggcatcgacgagaag
tccgaagggctggctatggcgcgcgagcgcggcgtcgccaccacgcatgaggggctcgac
ggtctgaaggcgatggacgtctatcccgagatcgggatcgtcttcgacgcgacgtccgct
tatgcccacaaggtgcacgatgcggcgctgcgcgccgacggcaagctggtggtggacctg
acgccggcggcgatcggccctttcaccattccgcccgtgaacatggaagagcatctggcc
gagggcaacgtcaacatggtgacgtgcggcggccaggcgaccatcccgatggtggcggcg
gtgagccaggtggccaaggtccattatgccgagatcgtggcttccgtctcgtcgcggtcg
gccggccccggcacccgcgccaatatcgacgagttcacccgcacgacggccagcgcgatc
gagaaggtgggcggcgccgaaaagggcaaggcgatcatcatcctcaaccccgccgagccg
ccgatgatcatgcgcgacacggtgttcacgctttccgaaggggccgatgaggagacgatc
cgcgcatcggtgaaggcgatggtggccaaggttcaggaatatgtgccgggatatcggctg
aagcaggaagtgcagttcgagcgcttcggcgacaacaacaagctgaagatccccggccgc
ggcgaattcaccggcatcaagacctcgatcttcctcgaggtggagggcgccggcgattac
ctgccgagctattcgggcaatctcgacatcatgactgccgccgccaaggcgactggcgag
ctgatggcgcgccgcctgctggaccagaaggccgcggcctga

DBGET integrated database retrieval system