KEGG   Sphingomonas sp. MM-1: G432_02145Help
Entry
G432_02145        CDS       T02498                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sphm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sphm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461673..462953
Genome map
AA seq 426 aa AA seqDB search
MVDFTDLVAAPEGRFDGIRRTYSPADVARLRGSVAIEHTLARRGAEKLWASLRSEPYINA
LGALTGNQAMQMVRAGLKAIYLSGWQVAADANTAGAMYPDQSLYPANAGPELARRINRTL
QRADQIEHSEGGAKRDWFVPIVADAEAGFGGPLNCFEIMKAYIEAGAAGVHFEDQLASEK
KCGHLGGKVLIPTQAHIRNLQAARLAADVCGVPTVLVARTDAESAKLITSDVDERDHEFL
TGERTPEGFFRLKDGTGVDHCIKRGIAFAEHADLLWWETSHPNLEDAKRFAEAVQKAHPG
KMMAYNCSPSFNWEAKLDKDTIARFQRELGAMGYKFQFVTLAGFHSLNHGMFELARGYKD
RGMAAYSELQQAEFASEAQGYTATRHQREVGTGYFDLVAEAVSGGMASTTALKESTEADQ
FAVAAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatttcaccgatctcgttgccgccccggagggccggttcgacggcatccgccgc
acctattcgcccgccgatgtcgcacggcttcggggatcggtggcgatcgagcatacgctg
gcgcggcgcggcgcggagaagctctgggcctcgctccggtccgaaccctatatcaacgcg
ctgggcgcgcttaccggcaaccaggcgatgcagatggtccgcgccgggctgaaggcgatc
tacctgtccggctggcaggtcgcggcggatgccaacaccgccggcgccatgtatcccgat
cagtcgctctatccggccaatgccgggccggagcttgcccgccggatcaaccgcaccctc
cagcgcgccgaccagatcgaacatagcgagggcggcgccaagcgcgactggttcgtgccg
atcgtcgccgatgcggaggccggcttcggcggcccgctcaactgcttcgagatcatgaag
gcctatatcgaggccggcgccgccggcgtccatttcgaggaccagctggcttctgaaaag
aagtgcggccatctgggcggcaaggtgctgatccccacgcaggcgcatatccgcaatctc
caggccgcccggctggcggcggacgtgtgcggcgtgcccaccgtgctggtggcgcgcacc
gacgcggaaagcgcgaagctcatcacctcggacgtagacgagcgcgaccatgaattcctg
accggcgaacgcacgccggaaggcttcttccgcctgaaggacggcaccggcgtcgatcat
tgcatcaagcgcggcatcgccttcgccgaacatgccgacctgctgtggtgggaaaccagc
catcccaatctggaggatgccaagcgctttgccgaggccgtgcagaaggcccaccccggc
aagatgatggcctacaactgctcgcccagcttcaactgggaggcgaagctggacaaggac
accatcgcccgtttccagcgcgaactgggggccatgggctacaagttccagttcgtcacg
ctggcgggcttccacagcctgaaccacggcatgttcgagctggcgcgcggctacaaggac
cgcggcatggccgcctattccgagctgcagcaggcggaattcgccagcgaggcgcagggc
tacaccgcgacccgccaccagcgcgaagtgggcaccggctatttcgacctggtggccgag
gcggtctcgggcggcatggcatcgaccacggcgctgaaggaatcgaccgaagccgatcag
ttcgccgtcgcggccgaatga

DBGET integrated database retrieval system