KEGG   Sphingomonas sp. MM-1: G432_09655Help
Entry
G432_09655        CDS       T02498                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    G432_09655
  Lipid metabolism
   00561 Glycerolipid metabolism
    G432_09655
   00600 Sphingolipid metabolism
    G432_09655
Enzymes [BR:sphm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     G432_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2010436..2012628)
Genome map
AA seq 730 aa AA seqDB search
MVSALALAALSAGGAHASARYDSKARVFRLDGGDVTYAFGINPAGYLESIYWGGRLQDGD
PLGPIPALRDHSSVDMAASIAPQEFPGQGAGTFAEPTLKLAYPDGVRDVVLKYVSHKIAG
DTITIALRDVSRPVDVTLRYEIDPETGIVGRSATIANNGKGWVRIDQAESASYTLPVGSD
YRLHYLTGRWAAEWTLQQRPVTEGATVIESRRGSTGHQNNPWFAIDRTAVSTEESGPVWF
GALAWSGSWRISVDKDQIGKVRIVGGYNPYDFAYRLQPGEKLETPVFYAGYSSRGMGGAS
RLMHRFQRDEILPGNGKPKIRPVLYNSWEATEFAVDEAGQMALAEKAARIGVERFVMDDG
WFGARNSDKAGLGDWTVNRTKFPNGLKPLIDKVKSLGMEFGLWVEPEMVNPDSDLYRAHP
DWVINFPTRPRSEGRNQLVLNLARKDVRDHLLKVLDDLVSANDIRFLKWDHNRNWSEPGW
PEVAPEDQQKLYVEYVRNLYWILAELRRRHPGLEIESCSGGGGRVDLGIMALTDQVWPSD
NTDPFDRLTMQDGFSHAYAPAVMMAWVTDSPNWVNKRETSLEYRFLSAMQGGLGVGANLN
HWQDEDYATATRMIAAYKTVRATVQQGDLYRLVSPQQGSEHSATLSVAPDRRQAVLFAFL
HSSTKLEPAPAIRLQGLDADRRYRVSRLGGGTLPAGMPVEASGRFWMEQGVDPALRGDFQ
AIGLLFEAVG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggtttcggcgctggcgctggccgcgctctcggctggcggcgcgcatgcgtcggcgcgc
tatgattcgaaggcccgcgtcttccggctggatggcggcgacgtcacctatgcgttcggc
atcaatcctgcgggctatctcgaatcgatctattggggggggcggctccaggacggcgat
cccctggggccgatcccggcgctgcgcgatcattccagcgtcgacatggcggcatcaatc
gcgccccaggagtttcccggccagggtgccggcaccttcgccgagcccacgctgaagctc
gcttatcccgatggcgtgcgggacgtcgtcctgaaatatgtctcccacaagatagcgggc
gacaccatcaccatcgctctcagggatgtttcccgcccggtcgacgtcaccctgcgctac
gagatcgatcccgaaaccggcatcgtcggccggtcggcgacgatcgcgaacaacggcaag
ggctgggtgcgaatcgaccaggccgaatccgcatcctacacgctgccggtcgggtcggat
taccggctccattacctcacaggccgctgggcggcggaatggacgctccagcagcggccg
gtgacggagggcgcgacggtgatcgaaagccggcgcggatcgaccggccaccagaataat
ccctggttcgcgatcgatcgcaccgccgtttcgaccgaggaaagcgggccggtatggttc
ggggcactcgcctggtcgggatcgtggcggatcagcgttgacaaggaccagatcggcaag
gtgcggatcgtcggtggctataatccctatgatttcgcctatcgcctccagccgggcgag
aagctggaaaccccggtcttctatgcgggctacagcagcaggggcatgggcggcgcctca
cgcctgatgcaccgcttccagcgtgacgagatcctgccgggcaacggcaagccgaagatt
cggcccgtgctctataatagctgggaagcgaccgaattcgccgtggacgaggccggtcag
atggcgctcgccgaaaaggcggcgcgcatcggtgtcgaacgcttcgtgatggacgacggc
tggttcggcgcgcgcaacagcgacaaggccggcctgggcgactggacggtcaaccgcacc
aaattccctaacggtctcaagccgctgatcgacaaggtgaagagcctggggatggaattc
ggcctgtgggtcgaacccgaaatggtgaatcccgacagcgatctctaccgcgcccatccc
gattgggtcatcaattttcccacccggccccgcagcgagggccgcaaccaactcgtcctc
aatctcgcacggaaggatgtgcgcgatcatctgctcaaagtgctggacgatctggtcagc
gccaacgacatcaggttcctcaaatgggatcataatcgcaactggtccgaacccggctgg
ccggaggtcgcgcctgaggaccagcagaagctctatgtcgaatatgtccgcaatctctat
tggatactggccgagctgcggcggcggcatccagggctggagatcgaatcctgctcgggc
ggcggtggccgcgtcgatctcggcatcatggccctcaccgatcaggtctggccgtcggac
aataccgacccctttgatcggctgacgatgcaggacggcttcagccatgcctatgcccca
gcggtgatgatggcctgggtcacggattcgcccaactgggtgaacaagcgggagacctcg
ctcgaatatcgcttcctgtccgcgatgcagggcggcctcggcgtcggcgccaacctcaac
cattggcaggatgaggattatgctaccgccacgcggatgatcgcggcctataaaactgtc
cgcgccacggtgcagcagggcgacctctatcgcctcgtctctccccagcaaggcagcgag
cactcggccacgctttcggttgcgccggaccggcgccaggcggtgcttttcgctttcctt
cacagcagcaccaagctggagccggcgcccgccatccggctccaaggcctcgatgccgac
aggcgctatcgcgtcagccgcctcggcggcggcacgttgccggccggcatgcccgtggaa
gccagcggtcgcttctggatggaacagggcgtcgatccggcgctgcggggggatttccag
gccatcggcctgctgttcgaagccgtcggctga

DBGET integrated database retrieval system