KEGG   Sphingomonas sp. MM-1: G432_11710Help
Entry
G432_11710        CDS       T02498                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    G432_11710
Enzymes [BR:sphm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     G432_11710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2464591..2465283)
Genome map
AA seq 230 aa AA seqDB search
MRRVLILRPEPGASATAARAAALELEAVVAPLFVTRPLPWQPPPADRFDAVMLTSAAAAR
LGGDGLAAYRALPAFAVGAATADAARAAGFADIQAGDADAPALLERIAAAGHRRLLHLAG
REHRAAAHPAIAIDRAIVYAADAVEALPRPARAALAEGAVALLHSPRAARHFAGLVDRAA
GIGIAAISPAVAEAAGKGWAAIGIADRPDDAALLAVAAALCDQADRLRNG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgcgtcctcatcctgcggcccgagccgggcgcgtcggccaccgccgcgcgggcg
gccgcgctggagctggaggcggtggtcgccccgctcttcgtcacaaggccgctgccctgg
caaccgccgccggcggaccggttcgatgccgtgatgctgacatccgccgccgccgcccgg
ctgggcggagacgggctggccgcctatcgcgcgctgcccgcgttcgcggtgggcgccgcc
accgccgatgccgcgcgggcggcgggctttgccgatatccaggccggcgatgccgatgca
ccggccctgctggagcggatcgccgccgccggccaccgccgtctgctgcatctcgccggt
cgcgagcatcgcgcggcggcgcatccggcgatcgccatcgatcgcgcgatcgtctatgcg
gccgatgccgtggaggcgctgccccggccggcgcgggcggccctggcggagggcgccgtg
gcgctgctccattcgccgcgcgcggcgcgccacttcgccggcctggtcgatcgggcggcg
ggcatcggcatcgccgcgatcagcccggccgtggccgaagccgccggcaagggctgggcc
gccatcggcatcgccgatcgccccgacgatgcggccctactggcggtggcggccgcgctg
tgcgatcaagcggatcgattgcgaaacggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system