KEGG   Sphingomonas sp. MM-1: G432_17290Help
Entry
G432_17290        CDS       T02498                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sphm  Sphingomonas sp. MM-1
Pathway
sphm00330  Arginine and proline metabolism
sphm00332  Carbapenem biosynthesis
sphm01100  Metabolic pathways
sphm01130  Biosynthesis of antibiotics
sphm01230  Biosynthesis of amino acids
Module
sphm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sphm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    G432_17290
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    G432_17290
Enzymes [BR:sphm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     G432_17290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGH51176
UniProt: M4S5Z0
Position
complement(3674573..3675715)
Genome map
AA seq 380 aa AA seqDB search
MVADLKGAAARFAPDACPRLVVKIGSALLVDPSGEVRRPWMAGVVADIADRIAAGQRVAV
VSSGAIALGARRLGLPKGGRASLEDAQAAAATGQIALSHCWAELLGERGLTAAQMLVTLD
DLEDRRRYLNASATLDRLMALGVVPVINENDSVATEEIRFGDNDRLAARIGQAAAARGVI
LLSDIDGLYTANPHRHADAELVAEVTRIDARIRAMADGGSASGMGSGGMISKLEAARIAM
SAGAHLAIISGKVERPLAAFAAGGRGTVFVAERGASARKAWLAGRLTARGSIHVDAGAAE
ALGNGRSLLPAGAVSVEGRFERGDVVDIIGPDSAPVARGLAEYDATDAARIVGRRSDALE
ALLGYAPRAALVHRTHMVLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctgaagggcgcggccgcgcgcttcgcgcccgatgcgtgcccccggctg
gtggtgaagatcggatcggccctgctggtcgatccgtcgggcgaagtgcggcggccgtgg
atggcgggcgtcgtggccgacatcgccgacaggatcgccgccgggcagcgcgtggcggtg
gtatcatccggcgcgatcgcgctcggcgcgcggcggctggggcttcccaagggcgggcgc
gccagcctggaggacgcgcaggcggcggcggcaacgggccagatcgcgctttcgcactgc
tgggccgagctgctcggcgaacggggcctcacggcggcgcagatgctggtgacgctggac
gatctggaagatcgccgccgttacctcaacgcatccgccacgctcgaccggctgatggcg
ctgggcgtggtgcccgtcatcaacgagaatgattcggtggcgaccgaggagatccggttc
ggcgacaatgaccggcttgcggcgcggatcggccaggcggcggccgcgcgcggcgtgatc
ctgctttcggatatcgacgggctctataccgccaatccccaccgccacgccgatgccgag
ctggtggccgaggtgacgcgcatcgacgcgcgcatccgggcgatggcggatggcggatcg
gcttcgggcatgggttccggcggcatgatatccaagctggaggccgcccggatcgcaatg
agcgccggcgcgcatctggcgatcatatcgggcaaggtggaacgccccctcgccgccttc
gcggcgggcgggcgcggcaccgttttcgtcgcggagcgcggcgcgtcggcccgcaaggcc
tggctggccggccgcctgacggccaggggctccatccacgtcgatgccggcgcggccgag
gcgctcggcaacggccgcagcctgctgccggcgggcgccgtttccgtggagggccggttc
gaacgcggcgacgtggtggacattatcggcccggattccgcccccgtcgcacgcggcctt
gccgaatatgacgccaccgacgcggcccgcatcgtcggccgccgatcggacgcgctggag
gcgctgctcggctacgcgccgcgcgccgctttggtccatcgcacccatatggtcctgctg
tga

DBGET integrated database retrieval system