KEGG   Sphingomonas sp. MM-1: G432_20720Help
Entry
G432_20720        CDS       T02498                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sphm  Sphingomonas sp. MM-1
Brite
Enzymes [BR:sphm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     G432_20720
Secretion system [BR:sphm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   G432_20720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pISP1:complement(48960..49832)
Genome map
AA seq 290 aa AA seqDB search
MSVTDRLRSLTWRSRLLVATVTGLSLAGIALAADASSAEDRVRALLKTRLPKTPVTAIDC
GKVGGLCEITAGENLFYVDSGARYLVIGRVYDMQTRQDITAARLLEMNPDMLVGSAARAN
ALARGGEEEGAQQLAAAPARVERPVASAQAHKLSLSGLPREGAIVWGNPSGQTVTVFSDF
RCGYCRALTGVLKDMNVRVVERPISVLGSRDVADRVYCARNREAALHAAYAGEPIKAGPA
CNTSGLDANEAFARRHGLSGTPVIVRGDGAVLEGYRPRAFLEKWLKEAQS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtaactgaccgtctccgctcgctgacctggcgatcgcgcctcctggtcgcgacc
gtcacgggtttaagcctggctgggatcgcgctcgctgccgatgcgagcagtgccgaggat
cgtgtcagggccttgttgaaaacgcggcttcccaagacaccagtaaccgcgatcgattgc
gggaaagtcggcggactgtgcgaaatcaccgcgggggagaacctcttctatgtggattcc
ggtgcccgctacctcgtgatcggccgggtctatgacatgcagaccaggcaggatattacg
gcggcgcggctgctcgagatgaatcccgacatgttggtcgggtccgcggcgcgcgcgaat
gcgctggcgcgtggcggtgaggaggaaggcgcgcagcaactggcagccgcgccggcgcgg
gttgagcgtcctgtcgcctctgcgcaagcgcacaagctttcgctttctggcttgccgcgg
gaaggcgcgatcgtctggggcaatccgtcgggtcagaccgtcacggttttttccgacttc
cggtgcggctattgccgtgccctgacgggcgttctcaaggacatgaacgtgcgggtcgtt
gaacggccgatctcggtgctgggcagccgggatgtcgccgaccgggtctattgcgccagg
aaccgcgaagccgcgcttcatgccgcctatgccggcgagccgatcaaggcggggcctgcc
tgcaacacgtcgggtctcgatgcgaacgaagccttcgcgcggcggcacgggctcagtggc
acgccggtgatcgtgcgcggcgacggggcggtgctcgaagggtatcggccgcgcgctttc
cttgagaagtggctcaaggaggcgcagtcatga

DBGET integrated database retrieval system