KEGG   Sphingopyxis sp. 113P3: LH20_00005Help
Entry
LH20_00005        CDS       T04069                                 

Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
sphp  Sphingopyxis sp. 113P3
Pathway
sphp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sphp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LH20_00005
DNA replication proteins [BR:sphp03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    LH20_00005
Chromosome [BR:sphp03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    LH20_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_19 Peptidase_A25
Motif
Other DBs
NCBI-ProteinID: ALC10332
UniProt: A0A0M4D6C4
Position
457..1821
Genome map
AA seq 454 aa AA seqDB search
MSGDAATLWPRVAEGLRRDLGVRTFDHWLKPVRFADYCSLSGVVTLETPSRFSANWINER
FGDRLELAWRHHLPAVRSVLVRAGAASSERSVAAMTPAPSLPGLQPPSAMTPAAASPFDA
RLSFDRFVVARSNILAANAARRMAMAEVPQFNPLYLCSGTGQGKTHLLHAIAQSYAAIDP
AATIILMSAEKFMLEFVGAMRGGDMMAFKTRLRAADLLLLDDLQFVIGKNSTQEELLHTI
DDLMTAGKRLVVTADRPPAMLDGVEARLLSRLSGGLVADIEAPEDDLRERIIRQRLAAMP
MVEVPDDVVAYLVKHFTRNIRELEGALNKLLAYAALTGARVDLTLAEDRLAENVRSARPR
ITIDEIQRAVCAHYRLDKAEMASKRRVRAVARPRQVAMYLAKELTPRSYPEIGRRFGGRD
HSTVIHAVRTVEALRVTDSELDAEIAAIRRSLNS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgatgccgcaacgctctggccgcgggtcgccgaagggctgcgccgcgacctc
ggcgtccgcacgttcgatcattggttaaagcctgtgcgctttgccgactattgttcgctc
tcgggggtggtgaccctcgaaaccccgagccgcttttcggcaaattggatcaatgagcga
ttcggcgaccggctggaacttgcgtggcggcatcatctgcctgcggtacgctcggtcctc
gttcgcgccggggctgcaagctcggagcgcagtgtcgcggcgatgacacctgcgccatcg
ctgcccggcctccagccgccctcggcgatgacacccgcggccgcctcgcccttcgatgcc
cgtctgagcttcgaccgcttcgtcgtcgcgcgctcgaacatcctggcggccaatgccgcg
cgccggatggccatggccgaggtgccgcagttcaatcctctctatctctgctccggaacc
ggacagggcaagacgcaccttctgcacgcaattgcgcaaagctatgccgcgatcgatccc
gcggcgacgatcattctgatgtcggcggagaagttcatgctcgagttcgtcggcgcgatg
cgcggcggcgacatgatggcattcaagacgcggctgcgcgcggccgatctgctgctgctc
gacgatctccagttcgtgatcgggaaaaattcgacgcaggaggaattgctccacacgatc
gacgatctgatgaccgcgggcaaacgcctcgtcgttaccgcagaccgcccgccggcgatg
ctcgacggagtcgaggcgcggctgctctcgcggctttcgggcgggcttgtcgctgatatc
gaggcgcccgaggatgacctacgcgaacgcattattcgccaacggctcgcggcgatgccg
atggtcgaagtgccggacgatgtcgtcgcctatctggtcaagcatttcacgcgcaacatc
cgcgagctcgagggcgcgctcaacaagctgctcgcctacgccgcccttaccggcgcgcgc
gtcgacttgacactcgccgaggaccggctcgccgaaaatgtgcgcagcgcgcgcccgcgc
atcacgatcgacgagatccagcgcgcggtttgcgcccattataggctcgacaaggccgag
atggcctccaagcgccgcgtccgtgcggtcgctcggccccgacaggtcgccatgtatctg
gcgaaagaactgacgccgcgttcctatcccgaaatcggccgtcgtttcggcgggcgcgac
cattcgacagtgatccacgccgtgcgtacagttgaggcgctgcgcgtcaccgacagtgaa
ctcgatgctgaaatcgcggccattcggcggagcctgaacagctga

DBGET integrated database retrieval system