KEGG   Sphingobium sp. TKS: K426_00675Help
Entry
K426_00675        CDS       T04965                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spht  Sphingobium sp. TKS
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:spht00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    K426_00675
   00630 Glyoxylate and dicarboxylate metabolism
    K426_00675
   00640 Propanoate metabolism
    K426_00675
   00650 Butanoate metabolism
    K426_00675
  Lipid metabolism
   00071 Fatty acid degradation
    K426_00675
   00072 Synthesis and degradation of ketone bodies
    K426_00675
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K426_00675
   00310 Lysine degradation
    K426_00675
   00380 Tryptophan metabolism
    K426_00675
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K426_00675
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K426_00675
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    K426_00675
Enzymes [BR:spht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K426_00675
Exosome [BR:spht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K426_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:136551..137015
Genome map
AA seq 154 aa AA seqDB search
MSDPVVIASYARTPIGGLQGLLSAVTATRLGSIAVGAAVERANVAPDAIARIYMGCVLPA
NLGQAPARQAVRGAGLPDSVEATTVNKMCGSGMQAAIMAFEALAAGTVDVVIAGGMESMT
NAPYLLPKHRSGARRARGSKRAGQCGRCGGCGCI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcctgtcgttatcgcgagctacgcccgtaccccgatcggcggactgcagggt
ctgctgtcagctgtgacggctacccggctcggctcaatcgccgtaggtgctgccgtcgag
cgcgcaaatgtagcaccggacgccatcgcccgcatctacatgggctgcgtcttgcccgcc
aacctgggccaagctcctgcgcggcaggcggtaagaggggccggtttgcccgacagcgtc
gaagccaccacggtcaacaagatgtgtggatcgggcatgcaggccgcgatcatggccttt
gaggcactcgccgccggaactgtcgatgtcgtgatcgcgggcggtatggagagcatgaca
aacgcaccctatctccttcccaagcatcgcagcggcgcgcgccgcgctcgcggaagcaaa
agagccggacaatgcggccgctgcggaggatgcggctgcatctga

DBGET integrated database retrieval system