KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0082Help
Entry
MGAS10750_Spy0082 CDS       T00356                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00900  Terpenoid backbone biosynthesis
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS10750_Spy0082
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MGAS10750_Spy0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABF37032
UniProt: Q1J8X9
Position
90715..91023
Genome map
AA seq 102 aa AA seqDB search
MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGS
DVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgatttcaagttaaaagaggagtttccgtttacttggaaaagcggattcct
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
ttatggctccttactcttagccgaaaagatatgatggatattggtataccgattggtagt
gatgtaccttattgcttgctttcaggttgtgcccaagtcactggtaaaggtgaagtggtt
tgtcgcattttggggctgttatcgtcttgggtggttttggttaaaccagattttggtatc
tcgacttga

DBGET integrated database retrieval system