KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0082Help
Entry
MGAS10750_Spy0082 CDS       T00356                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90715..91023
Genome map
AA seq 102 aa AA seqDB search
MKHRFQVKRGVSVYLEKRIPMCAGMGGGSSDAVTIRALNQLWLLTLSRKDMMDIGIPIGS
DVPYCLLSGCAQVTGKGEVVCRILGLLSSWVVLVKPDFGIST
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatcgatttcaagttaaaagaggagtttccgtttacttggaaaagcggattcct
atgtgtgctggtatgggaggaggttctagcgatgctgttactatcagagcattaaatcag
ttatggctccttactcttagccgaaaagatatgatggatattggtataccgattggtagt
gatgtaccttattgcttgctttcaggttgtgcccaagtcactggtaaaggtgaagtggtt
tgtcgcattttggggctgttatcgtcttgggtggttttggttaaaccagattttggtatc
tcgacttga

DBGET integrated database retrieval system