KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0083Help
Entry
MGAS10750_Spy0083 CDS       T00356                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS10750_Spy0083
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MGAS10750_Spy0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91063..91290
Genome map
AA seq 75 aa AA seqDB search
MSTTHLVAAIEAGNYNDGILTEMNNLLEDIFIAKRPFIQKIKEKTLQAGAATVLMTGSGP
TVFALCQTEKQTIIV
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
gtgtctactactcatttggttgcggcgattgaagcgggtaactataatgatgggatattg
actgaaatgaacaatttgctggaagatattttcattgccaagcgaccctttattcaaaaa
ataaaagagaaaacactacaagctggtgctgctactgttttgatgacaggaagtggaccg
actgtttttgctttgtgccaaaccgaaaaacaaactataatagtttaa

DBGET integrated database retrieval system