KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0498Help
Entry
MGAS10750_Spy0498 CDS       T00356                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00010  Glycolysis / Gluconeogenesis
spi00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10750_Spy0498 (bglA)
   00500 Starch and sucrose metabolism
    MGAS10750_Spy0498 (bglA)
Enzymes [BR:spi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MGAS10750_Spy0498 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABF37448
UniProt: Q1J7R3
Position
481340..482764
Genome map
AA seq 474 aa AA seqDB search
MGIFSKDFLWGGAVAANQVEGAFEADEKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQVAKAIEDGVEVMGYTAWGCIDC
VSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaattttttcaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgaaaaaggtttgtccgtacaagatgttctaccaaatggtgga
ctaggagaatggacagatagtcctaccagcgataatttaactttagaggcgattgatttt
taccaccgctacaaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagca
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggtatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcgctttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgaccttcaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagct
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttacccaatgacctctgatcct
cgtgatatacttgctgcgcatgcatttgaaaatcttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaagtcgtattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctatccttt
agctattacatgagtgtcacacaagcccacaatcctgaagcttacacatctggtcaggga
aatattctaggtggtttgtccaatccatatttagaatcttcggagtggggttggcagata
gacccaattggtctgcgattggtcttgaatcagtactatgaccgctaccagattcctttg
tttattgttgaaaatggcttaggtgcaaaggatcagctggtgcaaaccgcagatggcagc
atgacggttcacgatgattatcgcattgactacatgagtcagcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacactgcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagtaagcgctacggttttatttatgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcatttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaggataatttttcctaa

DBGET integrated database retrieval system