KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0829Help
Entry
MGAS10750_Spy0829 CDS       T00356                                 

Gene name
cpsFP
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00521  Streptomycin biosynthesis
spi00523  Polyketide sugar unit biosynthesis
spi01130  Biosynthesis of antibiotics
Module
spi_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MGAS10750_Spy0829 (cpsFP)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS10750_Spy0829 (cpsFP)
Enzymes [BR:spi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MGAS10750_Spy0829 (cpsFP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF4152
Motif
Other DBs
NCBI-ProteinID: ABF37779
UniProt: Q1J6Z5
Position
802197..802790
Genome map
AA seq 197 aa AA seqDB search
MTETFFDKPLACREIKEIPGLLEFDIPVRGDNRGWFKENFQKEKMLPIGFPERFFEEGKL
QNNVSFSRQHVLRGLHAEPWDKYISVADDGKVLGAWVDLREGETFGNVYQTVIDASKGMF
VPRGVANGFQVLSETVSYSYLVNDYWALDLKPKYAFVNYADPSLGITWENLAAAEVSEAD
KNHPLLSDVKPLKPKDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaactttttttgacaaaccattggcttgccgagaaatcaaagaaatcccaggc
ttactagagtttgatattcctgttcgtggggataatcgtggctggtttaaagaaaatttc
caaaaagaaaaaatgttgccaattggctttccagaacgtttttttgaggaaggaaaacta
caaaacaacgtttctttttcacgtcagcatgtgctgcgtggacttcatgctgaaccttgg
gataaatacatctcagttgctgatgatggcaaggttttaggagcttgggttgatcttcgt
gagggagagacttttggaaacgtctaccagacagtgattgatgcttcaaaaggaatgttt
gttcctagaggggttgctaatggctttcaagttctttcagagactgtctcttacagttat
cttgtcaatgactactgggctcttgacttgaaacctaagtatgcttttgtaaactatgct
gacccaagtcttgggattacttgggaaaatctagcagctgcagaagtttctgaagcagat
aaaaaccatcctcttcttagtgatgtcaaaccactgaaaccaaaagacctatag

DBGET integrated database retrieval system