KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0972Help
Entry
MGAS10750_Spy0972 CDS       T00356                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
922317..922919
Genome map
AA seq 200 aa AA seqDB search
MKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGLGK
DPKEEFTAVFKEQHEDVVIVKDISFYSICEHHLVPFYGKAHIAYLPSDGRVTGLSKLARA
VEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTTAR
GLYKESRAERQEVISLMTKD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaaaaagca
gaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaaggtctt
cttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactgggaaaa
gatcctaaagaggaatttacggctgtctttaaagaacagcatgaggatgtggtgattgtc
aaagacattagtttttattctatatgtgaacaccacttagttcctttttatggcaaggct
catatcgcttatttaccaagtgatggtcgagtaacaggtttgagtaaattagcgcgagca
gttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaatagcggat
gctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagagcacatg
tgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccactgccaga
ggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgacaaaagat
tag

DBGET integrated database retrieval system