KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy0973Help
Entry
MGAS10750_Spy0973 CDS       T00356                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS10750_Spy0973 (folP)
Enzymes [BR:spi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MGAS10750_Spy0973 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
922928..923719
Genome map
AA seq 263 aa AA seqDB search
MKIGKFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFG
FAKSVQQNMELLKGLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggggctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgaccgggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacagaatatggagttattaaaaggattggaccgcgtctgtcag
ttgggttatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gttttgagctag

DBGET integrated database retrieval system