KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1148Help
Entry
MGAS10750_Spy1148 CDS       T00356                                 

Gene name
malM
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGAS10750_Spy1148 (malM)
Enzymes [BR:spi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MGAS10750_Spy1148 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093326..1094819)
Genome map
AA seq 497 aa AA seqDB search
MNKRASGILIHISSLPGKFGIGTFGKSAFEFVDFLAETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFELLVDDELLEAADLCDITFGTNPEAVDYAQLFQVRRPLLEKAVRAFV
AEQENVCKLEAFETASSWLTDFAEFMALKEYFNNKALQDWDDETVIKRQEDSLNNYRELL
AKKITYHKVCQYFFYQQWSALKTYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
KPLFIAGVPADGFSEDGQLWGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGF
SDFWEIPAGDKTARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEEQVHFVNNYLH
KHADESITKAMLRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQ
DHKDYLIYLTDLYGRAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgcaagcggtatcttaatacatattagttccctgcctgggaaatttggg
ataggcacttttggaaaatcagcttttgaatttgttgattttctagcagagacgaaacaa
acctattggcaaattctgcctttaacaacgacgagttttggagattctccttatcagtca
ttttcagctattgctgggaacacacatttcattgattttgaattgctagtagatgatgaa
cttttagaagcagcagatttgtgtgatattacattcggcacaaatcctgaagcagtagac
tatgctcagctttttcaagttaggcgtccacttttagaaaaagcagtgagagcttttgtt
gctgaacaagaaaatgtgtgtaaattagaagcttttgaaacagcttctagctggttaact
gattttgctgaatttatggctttaaaagaatattttaacaataaagccttacaagattgg
gacgacgaaactgtcattaaacgccaagaagactcacttaataattaccgtgagttgctt
gcaaaaaagattacctatcataaagtctgtcaatacttcttttaccaacaatggtcagcc
ttgaaaacttacgctaaccataaagggatagaaattattggtgatatgcctatttatgtt
tctgcggacagtgtagaagtttggacgatgcctgagctatttaaagtagatagtgataaa
aagccattgtttattgcaggtgtaccagcagatggctttagtgaagatggtcagctgtgg
ggaaatccaacctacaattggtctgctcatgaaaagtctaattttgcatggtggatttat
cgtattcaagaaagtttcaaactatatgatcagctaagaatcgatcattttaaaggcttc
tcagatttttgggaaattcctgctggtgataaaactgctagaaatggccattgggcctca
gccccaggtatagcgttattttctgcggttcgtgaggccttaggagagcttcctatcatc
gcagaaaaccttggttatattgatgaaaaagcagagcagctattagcatcaacaggcttt
cctggcatgaagatattagaatttggtttatttgatataacgagtcaaagtatagatttg
ccacattactatgaccgtaattgtgtcgcttacacagggactcatgataacgaggtggtt
aacggatggtatgacaatcttagtgaagaacaagtacactttgtaaataactatcttcac
aaacatgcagatgaaagtattacaaaagccatgctaagaacaatctttgcttctgtttgt
gatacagccattctttgcatccaagatttattagataaagatggtaagagtcgtatgaat
atgccaaatacaattggaggtaattggcaatggcgtatgcttgacggtgaattgaaccaa
gatcacaaagactaccttatttatttaacagatctttatggtcgcgcaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system