KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1157Help
Entry
MGAS10750_Spy1157 CDS       T00356                                 

Definition
Cyclodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
Enzymes [BR:spi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.19  cyclomaltodextrin glucanotransferase
     MGAS10750_Spy1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104062..1104796)
Genome map
AA seq 244 aa AA seqDB search
MVIQLLMLKQPLPQNSYKDKLEGLLGGQELIVGADGTISSFELGAGQVAVWTYEGEDKTP
QLGDVDASVGIAGNKITISGQGFGNSKGQVTFGEISAEILSWSDTLITLKVPTVPANYYN
ISVTTADKQTSNSYQAFEVLTDKQIPVRLLINDFKTVPGEQLYLMGDVFEMGANDAKNAV
GPLFNNTQTIAKYPNWFFDTHLPINKEIAVKLVKKDSIGNVLWTSPETYSIKTGHEAQTI
TIKK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggttatacaattactaatgctaaaacagcccttgccccaaaatagctacaaggacaaa
ttagaaggtcttcttggcggtcaagaattaatagttggagcagatggcactattagtagc
tttgaacttggagcggggcaagtcgctgtatggacttatgaaggagaggacaagacacca
caacttggagatgtcgatgcttcagtgggtattgctggaaataagattactatttcaggt
caaggttttggtaattctaaaggtcaagtgacttttggagaaatctctgctgagatcctt
tcttggtcagatacccttatcaccttaaaagtaccgacggttccagcaaattattataac
atttcagtgacaactgccgataagcaaaccagcaatagttaccaagcctttgaagtattg
actgataaacaaattcctgttcgtttactcatcaatgattttaagacagtaccaggggaa
caactatatctcatgggtgatgtttttgagatgggggcaaatgacgctaagaatgctgtt
ggtcctctatttaataacactcagaccattgccaagtacccaaactggttctttgatact
catctaccaatcaataaagaaatagcagtcaaacttgttaaaaaagatagtattgggaat
gttttatggacaagtcctgagacttatagtataaagacaggtcatgaagcacaaaccatt
actataaaaaaataa

DBGET integrated database retrieval system