KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1158Help
Entry
MGAS10750_Spy1158 CDS       T00356                                 

Gene name
amyA
Definition
Cyclodextrin glucanotransferase
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104750..1106198)
Genome map
AA seq 482 aa AA seqDB search
MRELHIKTYKLLTKSAVLLGLISFPLTVSAADNASVTNKADFSTDTIYQIVTDRFNDGNT
SNNGKTDVFDKNDLKKYHGGDWQGIIAKIKDGYLTDMGISAIWISSPVENIDSIDPSNGS
AAYHGYWAKDFFKTNQHFGTEADFQQLVKVAHQHHIKVVIDFAPNHTSTAEKEGTTFKED
GALYKNGKLVGKFSDDKDKIFNHESWTDFSTYENSIYHSMYGLADLNNINPKVDQYMKEA
IDKWLDLGVDGIRVDAVKHMSQGWQKNWLSHIYEKHNVFVFGEWFSGHTDDDYDMTTFAN
NSGMGLLDFRFANAIRQLYTGFSTFTMRDFYKVLENRDQVTNEVTDQVTFIDNHDMERFA
TKVANNQTAVNQAYALLLTSRGVPNIYYGTEQYATGDKDPNNRGDMPSFNKESQAYKVIS
KLAPLRKQNQALAYGTTEQRWISDHVLVFERKFGNHVALVAINRDQTNGYTITNAKTALA
PK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagagaattacatatcaaaacttataagttattaacgaaaagtgctgttttacttggc
ttaatttcatttccactaactgtttctgctgccgataatgcttctgtcaccaacaaagca
gatttttcaacagatacgatttatcagattgtaacagatcgttttaacgatggtaatacc
tctaataatggtaagactgatgtttttgataaaaatgaccttaaaaaataccatggaggt
gattggcaaggaatcatcgccaagattaaggatggttacctgacagatatggggatttct
gccatttggatttcttctcctgttgaaaatatcgacagtattgatccttctaatggaagt
gctgcatatcatgggtattgggctaaggacttctttaaaacaaaccagcattttggcact
gaagcagactttcaacaactagtcaaagtagctcatcaacaccatattaaggtagttatt
gattttgctcctaatcatacgtctacagccgaaaaagaaggcacaactttcaaagaagat
ggcgctttatataaaaacggtaaattagttggtaaattttcagatgataaagacaagatt
tttaatcatgaatcttggaccgattttagtacttatgaaaattctatttatcattcaatg
tacggactagctgatttaaataacattaatccgaaagttgaccagtacatgaaagaagct
attgataaatggttagacctgggtgttgatggtatccgagttgacgctgttaaacatatg
tcacaaggttggcaaaaaaattggttgagtcatatctatgaaaaacataatgtctttgtt
ttcggggaatggttctcgggacataccgacgatgattatgatatgacgacatttgctaac
aatagtgggatggggcttttagattttagatttgccaatgctattagacagttgtataca
ggtttttcaacgtttaccatgcgagatttttacaaggttcttgaaaatagagatcaggtg
actaatgaagtgacagaccaggtgacctttattgataatcatgatatggaacgcttcgca
acaaaagtggctaataatcaaactgctgttaatcaagcctatgctttgcttttaacatct
agaggtgtgcctaatatttattatggtacagagcagtatgcaacaggtgataaagatcct
aataatcgtggtgatatgccaagttttaataaagagtcacaagcctataaagtgattagt
aagctagctcctttaagaaaacaaaatcaagctttagcttatggaacaactgaacaacgt
tggattagtgatcatgttttggtatttgagcgtaaatttggtaatcatgtcgcactagtg
gctattaatagagatcaaacgaatggttatacaattactaatgctaaaacagcccttgcc
ccaaaatag

DBGET integrated database retrieval system