KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1272Help
Entry
MGAS10750_Spy1272 CDS       T00356                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00010  Glycolysis / Gluconeogenesis
spi00260  Glycine, serine and threonine metabolism
spi00680  Methane metabolism
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01120  Microbial metabolism in diverse environments
spi01130  Biosynthesis of antibiotics
spi01200  Carbon metabolism
spi01230  Biosynthesis of amino acids
Module
spi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10750_Spy1272 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MGAS10750_Spy1272 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGAS10750_Spy1272 (gpmA)
Enzymes [BR:spi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MGAS10750_Spy1272 (gpmA)
Membrane trafficking [BR:spi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MGAS10750_Spy1272 (gpmA)
Exosome [BR:spi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MGAS10750_Spy1272 (gpmA)
  Exosomal proteins of melanoma cells
   MGAS10750_Spy1272 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF38222
UniProt: Q1J5W1
Position
complement(1216286..1216981)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggt
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system