KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1420Help
Entry
MGAS10750_Spy1420 CDS       T00356                                 

Definition
(GenBank) Glucokinase / transcription regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00010  Glycolysis / Gluconeogenesis
spi00052  Galactose metabolism
spi00500  Starch and sucrose metabolism
spi00520  Amino sugar and nucleotide sugar metabolism
spi00521  Streptomycin biosynthesis
spi01100  Metabolic pathways
spi01110  Biosynthesis of secondary metabolites
spi01120  Microbial metabolism in diverse environments
spi01130  Biosynthesis of antibiotics
spi01200  Carbon metabolism
Module
spi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS10750_Spy1420
   00052 Galactose metabolism
    MGAS10750_Spy1420
   00500 Starch and sucrose metabolism
    MGAS10750_Spy1420
   00520 Amino sugar and nucleotide sugar metabolism
    MGAS10750_Spy1420
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MGAS10750_Spy1420
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MGAS10750_Spy1420
Enzymes [BR:spi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MGAS10750_Spy1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ABF38370
UniProt: Q1J5L6
Position
1346466..1347389
Genome map
AA seq 307 aa AA seqDB search
MRHDRLFYYNKGEHLMSLLCLDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
VARYSAYHFSGIAVSAPGAVNKEKGIIEGASAIPYIHHFKIQEALEERLHYPISIENDAN
CAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQTF
SQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDHLAIKERQVFLQSLAIGIFNIQHA
FDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGAAIDF
YQEHKEA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagacatgatcgtctattctactacaataaaggagaacacctcatgagcttgttatgt
cttgatataggaggcacttcccttaaatttgccctctgtcacaatggccaattaagccag
caaagcagctttcccactccctctagtctggaaaagttttaccaattactcgaccaagaa
gttgctcgttactctgcttaccatttctcaggtattgccgttagtgctcctggagcggtt
aacaaggaaaaaggtattatcgaaggagccagcgccattccctacattcaccattttaaa
atacaagaggccttagaagaacggctacattaccctatttctatcgaaaatgatgccaat
tgtgccgccttagctgaagctaccttaggggcaggaaaaggcgctagtagcctagccatg
ctcgttcttggtactggagttggaggaagcttggtcattgatggcaagatttaccatggt
gcccacttatttgggggcgaatttggtttcatgatcatgaacgaccgctaccaaaccttt
agtcagttagggacagtggtaaatatggccaagcgctatagtgcaatcgtcaataacgga
aaagattatactggcaaagctgtccttgccctcgcagaacaaggagaccacctagcaatc
aaagaaaggcaggtctttctccaaagtttagccatcggtatttttaacattcaacacgcc
tttgatcctcaactgattttaatcgggggtggtgtttcccaagctgactttctactgtca
gcgattgaagctgaactagacaaactctaccaagccgtcgaaatctccgaccttagaccc
caattagctatttgtcactttaaaaacgaagctaatcttctgggagctgccattgatttt
taccaagaacacaaggaggcctaa

DBGET integrated database retrieval system