KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1491Help
Entry
MGAS10750_Spy1491 CDS       T00356                                 

Gene name
glpO
Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spi00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1428658..1430496)
Genome map
AA seq 612 aa AA seqDB search
MEFSRETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAQGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGALIASHVKAEDFLLDDNGKIIGVKARDLLSDQEIIIKAKLVINTTGPWSDEI
RQFSHKGRPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLNDGRMVFVLPREEKTYFGTT
DTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVETSTSEKELDPSAVSRGSSFDR
DENGLFTLAGGKITDYRKMAEGALTGIIQILKEEFGKSFKLINSKTYPVSGGEINPANVD
SEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFALTRQLTAAEGLSLAETLSLHYAMD
YEMALKPTDYFLRRTNHLLFMRDSLDALIDPVINEMAKHFEWSDQERVAQEDDLRRVIAD
NDLSALKGHQEG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaagagaaacaagacgcttagctctccaaaaaatgcaagaaagagattta
gacctactgattattgggggaggtattacgggtgctggtgtggcgcttcaggcggcagct
agtggcctagatacgggtctgattgagatgcaagattttgcgcaaggaacctctagccgt
tcaaccaaattggttcacggggggcttcgttacttgaaacaatttgatgtggaggtggtt
tcagatacggtgtcagagcgggctgtggtgcaacaaattgcaccccacattccaaaacca
gaccctatgttattacctgtttatgacgaacctggtagtacctttagcatgttccgtttg
aaggtcgctatggatttgtatgatcttttagcaggcgtgtccaatacgccagcggccaac
aaggtgttaaccaaagaagaagtcttaaaacgagaaccagacttaaaacaagaaggcttg
cttggtggtggggtttaccttgatttccgtaataatgacgcaaggcttgttattgaaaat
atcaaacgagctaatcgtgatggggctcttattgctagtcatgtgaaagcagaagatttc
ttgctagatgacaatggtaagattattggtgtgaaggcgcgtgatttgctgtcagatcaa
gaaatcattatcaaggctaaattagtcatcaacaccacaggtccatggagtgatgagatt
cgtcaattctctcataagggacgaccgattcatcaaatgcgccctacaaaaggggtgcat
ctggtagtggaccgtcaaaaattaccagtgtctcaacctgtctatgttgacacagggtta
aatgatggtcgtatggtctttgtcttgccacgtgaagaaaaaacttattttggaacaacg
gacacggactacactggagacttggagcacccacaagttactcaagaagatgtggattat
ttgttaggcgttgtcaataaccgctttccaaatgccaacgtgaccattgatgatattgaa
agcagttgggctggtcttcgccccttgttatcaggtaatagtgcttctgactacaatggt
ggcaacagcggtaaagtcagtgatgatagttttgatcacttggttgatactgtcaaagcc
tatattaaccacgaagatagccgagaagctgttgaaaaagctattaagcaggttgaaacc
agcacatctgaaaaagaattggatccgtctgcagtgtcacgaggttcaagttttgaccgt
gatgagaatggactctttaccttggcaggtggtaagattaccgactatcgcaaaatggct
gaaggagcattgacagggattattcaaatcctcaaagaagagtttggcaaatccttcaag
cttatcaattcaaaaacctatcctgtttcaggaggtgaaatcaatccagccaatgtagat
tcggaaatagaagcctatgctcaattaggaactcttagtggtctttcgatggatgatgct
aggtatttggcaaacctttatggttctaatgcgccaaaagtctttgccttaactcgtcaa
ttaacagcagctgaagggttaagtttagctgaaaccttgtccttacattatgcgatggat
tatgaaatggctcttaaaccgacagattatttcttgagaagaacaaatcacctcttattt
atgcgagatagcctagatgctttgattgacccagtgattaatgaaatggctaaacatttt
gaatggtctgatcaggaaagagtggcacaagaagacgatcttcgtcgcgtgattgcagac
aatgatttgagtgccttaaaaggccatcaggagggttaa

DBGET integrated database retrieval system