KEGG   Spiribacter sp. UAH-SP71: SPICUR_00670Help
Entry
SPICUR_00670      CDS       T02888                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:spiu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SPICUR_00670
Enzymes [BR:spiu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SPICUR_00670
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SPICUR_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
135843..136505
Genome map
AA seq 220 aa AA seqDB search
MDRRAKYLIMRLDSDNALLIHLGMSGYIRVVPRATPPQKHDHIDLVFSNDRCLRFHDPRR
FGSVHLIDEPAESHALLSKLGPEPFDDRFDGAYLYAIADKRRLAVKSFIMDSHIVVGVGN
IYATEALHRAGIHPGRSAGRVSQRRYDRLAASIQAVLSEAIEAGGTTLRDFARSDGQPGY
FQQSLDAYGRGGTTCPRCGRTMRSTRLAQRATVYCPGCQR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttggaccggcgcgccaagtatctgattatgcggctcgattcggataacgcactgcttatt
catttgggtatgtccggctatatccgcgttgtcccacgcgcaacgccgcctcagaagcat
gaccacattgatctggtattcagtaacgaccgatgcctccgcttccatgatccccgtcgg
ttcgggagcgttcatttgattgacgagcctgccgaatcgcacgctctgctaagcaaactc
ggacctgagcccttcgatgacaggttcgatggcgcctatctgtatgccatagcggataag
cgtcgattagcggtcaaatcgttcatcatggacagtcatatcgttgtcggtgtcggtaac
atctacgccaccgaggcactgcaccgggctggtattcatcccggacgcagcgcgggacgg
gtttcccagcgccgctacgatagactcgccgcctccattcaagccgtcttgtccgaggct
attgaggcaggtggcacgaccttgcgggatttcgcccgcagcgatggccagccgggctat
ttccagcagtcactggacgcttacgggcgaggtgggacgacgtgcccgcgctgtgggagg
acgatgcgctcaacacgactcgctcagcgtgccaccgtctattgccctggctgccagcgc
tga

DBGET integrated database retrieval system